GlyCosmos Portal

Submissions

Clusterin

Summary

UniProt ID: P25473
Gene Symbol: CLU
Gene ID: 442971
Organism: Canis lupus familiaris (dog)

External Links

PubChem: P25473
Re-Glyco: P25473

Annotation

Keyword: Chaperone Cytoplasm Cytoplasmic vesicle Disulfide bond Glycoprotein Membrane Microsome Mitochondrion Nucleus Phosphoprotein Reference proteome Secreted Signal Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of activation of membrane attack complex	ISS	GO_REF
immune complex clearance	ISS	GO_REF
protein folding	ISS	GO_REF
negative regulation of protein-containing complex assembly	ISS	GO_REF
positive regulation of proteasomal ubiquitin-dependent protein catabolic process	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

immune complex clearance

cellular process [inference]

protein folding

signal transduction [inference]

intracellular signal transduction [inference]

intrinsic apoptotic signaling pathway

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway

response to stimulus [inference]

response to stress [inference]

response to topologically incorrect protein [inference]

response to misfolded protein

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

negative regulation of immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of immune effector process [inference]

negative regulation of immune effector process [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of complement activation [inference]

regulation of activation of membrane attack complex [inference]

negative regulation of activation of membrane attack complex

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of immune response [inference]

regulation of humoral immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of complement activation [inference]

regulation of activation of membrane attack complex [inference]

negative regulation of activation of membrane attack complex

negative regulation of complement activation

negative regulation of activation of membrane attack complex

negative regulation of immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

positive regulation of receptor-mediated endocytosis

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of immune effector process [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

negative regulation of immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of immune response [inference]

regulation of humoral immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of complement activation [inference]

regulation of activation of membrane attack complex [inference]

negative regulation of activation of membrane attack complex

negative regulation of complement activation

negative regulation of activation of membrane attack complex

negative regulation of immune response [inference]

negative regulation of humoral immune response [inference]

negative regulation of complement activation

negative regulation of activation of membrane attack complex

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intrinsic apoptotic signaling pathway

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of proteasomal protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of proteasomal protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

regulation of amyloid fibril formation [inference]

negative regulation of amyloid fibril formation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of proteasomal protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

regulation of amyloid fibril formation [inference]

negative regulation of amyloid fibril formation

regulation of cell killing [inference]

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

regulation of complement-dependent cytotoxicity [inference]

negative regulation of complement-dependent cytotoxicity

regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process [inference]

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of protein metabolic process [inference]

negative regulation of amyloid fibril formation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of protein-containing complex assembly [inference]

negative regulation of protein-containing complex assembly

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of supramolecular fiber organization [inference]

negative regulation of supramolecular fiber organization [inference]

negative regulation of amyloid fibril formation

regulation of amyloid fibril formation [inference]

negative regulation of amyloid fibril formation

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of cellular response to stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleus	ISS	GO_REF
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF GO_REF
mitochondrion	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

protein-lipid complex [inference]

lipoprotein particle [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

extracellular protein-containing complex [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

cellular anatomical structure [inference]

cytosol

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

perinuclear endoplasmic reticulum lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

chromaffin granule

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

chromaffin granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

chromaffin granule

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
ubiquitin protein ligase binding	ISS	GO_REF
unfolded protein binding
protein-folding chaperone binding	IPI	PMID
misfolded protein binding	ISS	GO_REF
misfolded protein binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

molecular sequestering activity [inference]

protein sequestering activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MMKTLLLLVGLLLTWDNGRVLGDQAVSDTELQEMSTEGSKYINKEIKNALKGVKQIKTLIEQTNEERKSLLSNLEEAKKKKEDALNDTKDSETKLKASQGVCNDTMMALWEECKPCLKQTCMKFYARVCRSGSGLVGHQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHALDVMQDSFNRASSIMDELFQDRFFTREPQDTYHYSPFSLFQRRPFFNPKFRIARNIIPFPRFQPLNFHDMFQPFFDMIHQAQQAMDVNLHRIPYHFPIEFPEEDNRTVCKEIRHNSTGCLKMKDQCEKCQEILSVDCSSNNPAQVQLRQELSNSLQIAEKFTKLYDELLQSYQEKMFNTSSLLKQLNEQFSWVSQLANLTQSEDPFYLQVTTVGSQTSDSNVPVGFTKVVVKLFDSDPITVMIPEAVSRNNPKFMETVAEKALQEYRQKHREE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	Description	Source
86	N-linked (GlcNAc...) asparagine	UniProt
103	N-linked (GlcNAc...) asparagine	UniProt
145	N-linked (GlcNAc...) asparagine	UniProt
277	N-linked (GlcNAc...) asparagine	UniProt
287	N-linked (GlcNAc...) asparagine	UniProt
350	N-linked (GlcNAc...) asparagine	UniProt
370	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Platelet degranulation	Canis familiaris
Regulation of Complement cascade	Canis familiaris
Terminal pathway of complement	Canis familiaris

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements