GlyCosmos Portal

Submissions

Protein PBN1

Summary

UniProt ID

P25580

Gene Symbol

PBN1
YCL052C
YCL52C

Gene ID

[850305]

Organism

Saccharomyces cerevisiae S288C

External Links

Re-Glyco: P25580

Annotation

Keyword: Endoplasmic reticulum GPI-anchor biosynthesis Glycoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GPI anchor biosynthetic process	IMP	PMID
GPI anchor biosynthetic process	IBA	GO_REF
GPI anchor biosynthetic process	IEA	GO_REF GO_REF
protein processing	IMP	PMID
fungal-type cell wall organization	NAS	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

biosynthetic process [inference]

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

organophosphate biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

protein metabolic process [inference]

proteolysis [inference]

protein processing

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

protein maturation [inference]

protein processing

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

lipid biosynthetic process [inference]

phospholipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

glycerolipid biosynthetic process [inference]

glycerophospholipid biosynthetic process [inference]

GPI anchor biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

protein metabolic process [inference]

proteolysis [inference]

protein processing

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

protein maturation [inference]

protein processing

carbohydrate derivative metabolic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

GPI anchor metabolic process [inference]

GPI anchor biosynthetic process

glycolipid biosynthetic process [inference]

GPI anchor biosynthetic process

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

ERAD pathway

cell wall organization or biogenesis [inference]

cell wall organization [inference]

fungal-type cell wall organization

fungal-type cell wall organization or biogenesis [inference]

fungal-type cell wall organization

cellular component organization or biogenesis [inference]

cellular component organization [inference]

external encapsulating structure organization [inference]

cell wall organization [inference]

fungal-type cell wall organization

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

ERAD pathway

response to chemical [inference]

ERAD pathway

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

ERAD pathway

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum	HDA	PMID
endoplasmic reticulum membrane	NAS	PMID
endoplasmic reticulum membrane	IEA	GO_REF GO_REF
glycosylphosphatidylinositol-mannosyltransferase I complex	NAS	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

endoplasmic reticulum protein-containing complex [inference]

glycosylphosphatidylinositol-mannosyltransferase I complex

intracellular protein-containing complex [inference]

mannosyltransferase complex [inference]

glycosylphosphatidylinositol-mannosyltransferase I complex

catalytic complex [inference]

transferase complex [inference]

mannosyltransferase complex [inference]

glycosylphosphatidylinositol-mannosyltransferase I complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVTRHRVTVLYNAPEDIGNHMRQNDTHLTVRGGSGVVLQQRWLLERTGSLDKSFTRITWRPRADLARSLSVIENELSAGFSVYSNSSDVPERFITNPVYNSFHSEKFDIEQYLPPEVDLNLSWNPEDFTYDISVEPTQIQIVEYRLLKQGEEFTIARVKDEKLEVGVFFVDASDESDVDIGGIRCNWRMDDGKMERCQKTSLLYKQGHIAYNHSTTTTSLYLNEPIGLHPKIMIDLTDFEERPKCMYLMHLQLPLELFIDKFQSSPLLLFGEDDLELPEYSLRDKAWGSESIFELKAGTMNEVTLHTRYIEPSNNKGDKLEVSFDPEVILACDTGDNKVSRNPFYKKGLGYESLFTDDTTFRHLNSTTLLVPIPRPDTKDYSKIKNGTLLCLLISIIYIFSKVFGNNKKKRSVKRE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
24	N-linked (GlcNAc...) asparagine	UniProt
85	N-linked (GlcNAc...) asparagine	UniProt
120	N-linked (GlcNAc...) asparagine	UniProt
212	N-linked (GlcNAc...) asparagine	UniProt
365	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements