GlyCosmos Portal

Submissions

Procathepsin L

Summary

UniProt ID

P25975

Gene Symbol

CTSL
CTSL1

Gene ID

281108

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P25975
Re-Glyco: P25975

Annotation

Keyword: Cell membrane Cytoplasmic vesicle Direct protein sequencing Disulfide bond Glycoprotein Lysosome Metal-binding Reference proteome Secreted Signal Thiol protease Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein autoprocessing	ISS	GO_REF
collagen catabolic process	ISS	GO_REF
zymogen activation	ISS	GO_REF
enkephalin processing	IDA	PMID
CD4-positive, alpha-beta T cell lineage commitment	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

antigen processing and presentation [inference]

antigen processing and presentation of peptide antigen

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

collagen catabolic process

carbohydrate derivative catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

collagen metabolic process [inference]

collagen catabolic process

hormone metabolic process [inference]

peptide hormone processing [inference]

enkephalin processing

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

enkephalin processing

glycoprotein metabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

elastin metabolic process [inference]

elastin catabolic process

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

protein maturation [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

enkephalin processing

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

enkephalin processing

glycoprotein metabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

elastin metabolic process [inference]

elastin catabolic process

protein catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

protein maturation [inference]

protein processing [inference]

signaling receptor ligand precursor processing [inference]

peptide hormone processing [inference]

enkephalin processing

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

elastin metabolic process [inference]

elastin catabolic process

carbohydrate derivative catabolic process [inference]

glycoprotein catabolic process [inference]

elastin catabolic process

cellular developmental process [inference]

cell fate commitment [inference]

T cell lineage commitment [inference]

alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment

CD4-positive or CD8-positive, alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment

developmental process [inference]

cellular developmental process [inference]

cell fate commitment [inference]

T cell lineage commitment [inference]

alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment

CD4-positive or CD8-positive, alpha-beta T cell lineage commitment [inference]

CD4-positive, alpha-beta T cell lineage commitment

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

peptide hormone processing [inference]

enkephalin processing

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
lysosome	ISS	GO_REF
lysosome	IBA	GO_REF
lysosome	IEA	GO_REF
apical plasma membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane region [inference]

apical plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

chromaffin granule

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

chromaffin granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

chromaffin granule

Displaying **all 4** entries
GO Term	Evidence Code	Reference
endopeptidase activity	ISS	GO_REF
cysteine-type endopeptidase activity	ISS	GO_REF
cysteine-type endopeptidase activity	IEA	GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity

cysteine-type endopeptidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity

cysteine-type endopeptidase activity

cysteine-type peptidase activity [inference]

cysteine-type endopeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNPSFFLTVLCLGVASAAPKLDPNLDAHWHQWKATHRRLYGMNEEEWRRAVWEKNKKIIDLHNQEYSEGKHGFRMAMNAFGDMTNEEFRQVMNGFQNQKHKKGKLFHEPLLVDVPKSVDWTKKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRAQGNQGCNGGLMDNAFQYIKDNGGLDSEESYPYLATDTNSCNYKPECSAANDTGFVDIPQREKALMKAVATVGPISVAIDAGHTSFQFYKSGIYYDPDCSSKDLDHGVLVVGYGFEGTDSNNNKFWIVKNSWGPEWGWNGYVKMAKDQNNHCGIATAASYPTV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
222	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Activation of Matrix Metalloproteinases	Bos taurus
Degradation of the extracellular matrix	Bos taurus
MHC class II antigen presentation	Bos taurus
RUNX1 regulates transcription of genes involved in differentiation of keratinocytes	Bos taurus
Trafficking and processing of endosomal TLR	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements