GlyCosmos Portal

Submissions

Glutathione S-transferase Mu 2

Summary

UniProt ID: P28161
Gene Symbol: GSTM2 GST4
Gene ID: 2946
Organism: Homo sapiens (human)

External Links

GlyGen

P28161

PubChem

P28161

SwissLipids

SLP:000001614

The Human Metabolome Database

HMDBP00808

O-GlcNAcAtlas

P28161

Re-Glyco

P28161

Annotation

Keyword: 3D-structure Alternative splicing Cytoplasm Direct protein sequencing Lipid metabolism Phosphoprotein Proteomics identification Reference proteome Transferase

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
glutathione metabolic process	IDA	PMID PMID PMID
glutathione metabolic process	IBA	GO_REF
glutathione metabolic process	IEA	GO_REF
regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum	IDA	PMID
regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion	IDA	PMID PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling [inference]

regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion

regulation of skeletal muscle contraction by calcium ion signaling [inference]

regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion

metabolic process [inference]

modified amino acid metabolic process [inference]

glutathione metabolic process

sulfur compound metabolic process [inference]

glutathione metabolic process

xenobiotic metabolic process [inference]

xenobiotic catabolic process

catabolic process [inference]

xenobiotic catabolic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

benzene-containing compound metabolic process [inference]

nitrobenzene metabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

linoleic acid metabolic process

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

unsaturated fatty acid metabolic process [inference]

linoleic acid metabolic process

lipid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

long-chain fatty acid metabolic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

linoleic acid metabolic process

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

unsaturated fatty acid metabolic process [inference]

linoleic acid metabolic process

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process [inference]

long-chain fatty acid biosynthetic process [inference]

hepoxilin biosynthetic process

olefinic compound metabolic process [inference]

linoleic acid metabolic process

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to caffeine

cellular detoxification [inference]

cellular detoxification of nitrogen compound

multicellular organismal process [inference]

system process [inference]

muscle system process [inference]

relaxation of muscle [inference]

relaxation of cardiac muscle

response to stimulus [inference]

response to chemical [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to caffeine

response to nitrogen compound [inference]

response to purine-containing compound [inference]

response to caffeine [inference]

cellular response to caffeine

cellular response to purine-containing compound [inference]

cellular response to caffeine

response to alkaloid [inference]

response to caffeine [inference]

cellular response to caffeine

cellular response to alkaloid [inference]

cellular response to caffeine

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to caffeine

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to caffeine

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling [inference]

regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion

regulation of skeletal muscle contraction by calcium ion signaling [inference]

regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport [inference]

regulation of release of sequestered calcium ion into cytosol [inference]

regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of striated muscle contraction [inference]

regulation of skeletal muscle contraction [inference]

regulation of skeletal muscle contraction by calcium ion signaling [inference]

regulation of skeletal muscle contraction by regulation of release of sequestered calcium ion

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling [inference]

regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion

regulation of blood circulation [inference]

regulation of heart contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling [inference]

regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion

detoxification [inference]

detoxification of nitrogen compound [inference]

cellular detoxification of nitrogen compound

cellular detoxification [inference]

cellular detoxification of nitrogen compound

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	IDA	PMID PMID
cytoplasm	IEA	GO_REF
cytosol	TAS	Reactome
cytosol	IDA	GO_REF
sarcoplasmic reticulum	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum [inference]

sarcoplasmic reticulum

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum [inference]

sarcoplasmic reticulum

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
glutathione transferase activity	IDA	PMID PMID PMID
glutathione transferase activity	IBA	GO_REF
glutathione transferase activity	IEA	GO_REF GO_REF GO_REF GO_REF
glutathione peroxidase activity	IDA	PMID
fatty acid binding	IPI	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on peroxide as acceptor [inference]

peroxidase activity [inference]

glutathione peroxidase activity

transferase activity [inference]

transferase activity, transferring alkyl or aryl (other than methyl) groups [inference]

glutathione transferase activity

binding [inference]

protein binding [inference]

enzyme binding

identical protein binding [inference]

protein homodimerization activity

transmembrane transporter binding

protein dimerization activity [inference]

protein homodimerization activity

lipid binding [inference]

fatty acid binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

fatty acid binding

glutathione binding

organic acid binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

fatty acid binding

modified amino acid binding [inference]

glutathione binding

oligopeptide binding [inference]

glutathione binding

sulfur compound binding [inference]

glutathione binding

antioxidant activity [inference]

peroxidase activity [inference]

glutathione peroxidase activity

molecular function regulator activity [inference]

molecular function inhibitor activity [inference]

transporter inhibitor activity [inference]

channel inhibitor activity [inference]

ion channel inhibitor activity [inference]

calcium channel inhibitor activity

transporter regulator activity [inference]

channel regulator activity [inference]

channel inhibitor activity [inference]

ion channel inhibitor activity [inference]

calcium channel inhibitor activity

ion channel regulator activity [inference]

calcium channel regulator activity [inference]

calcium channel inhibitor activity

ion channel inhibitor activity [inference]

calcium channel inhibitor activity

transporter inhibitor activity [inference]

channel inhibitor activity [inference]

ion channel inhibitor activity [inference]

calcium channel inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites