GlyCosmos Portal

Submissions

Adenosine receptor A1

Summary

UniProt ID

P28190

Gene Symbol

ADORA1

Gene ID

282133

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P28190
Re-Glyco: P28190

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Palmitate Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of leukocyte migration
regulation of glomerular filtration
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF
response to purine-containing compound	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

cell motility [inference]

cell migration [inference]

leukocyte migration

multicellular organismal process [inference]

secretion by tissue [inference]

mucus secretion

response to stimulus [inference]

response to chemical [inference]

response to nitrogen compound [inference]

response to purine-containing compound

localization [inference]

establishment of localization [inference]

transport [inference]

secretion [inference]

body fluid secretion [inference]

mucus secretion

secretion by tissue [inference]

mucus secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte migration

regulation of leukocyte migration [inference]

negative regulation of leukocyte migration

regulation of signaling [inference]

positive regulation of signaling [inference]

positive regulation of synaptic transmission [inference]

negative regulation of long-term synaptic depression

negative regulation of signaling [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

long-term synaptic depression

regulation of long-term synaptic depression [inference]

negative regulation of long-term synaptic depression

negative regulation of synaptic transmission [inference]

long-term synaptic depression

positive regulation of synaptic transmission [inference]

negative regulation of long-term synaptic depression

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

negative regulation of secretion [inference]

negative regulation of mucus secretion

regulation of mucus secretion [inference]

negative regulation of mucus secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of mucus secretion

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

negative regulation of leukocyte migration

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of synaptic transmission [inference]

negative regulation of long-term synaptic depression

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of synaptic transmission [inference]

negative regulation of long-term synaptic depression

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte migration

negative regulation of signaling [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of mucus secretion

negative regulation of multicellular organismal process [inference]

negative regulation of mucus secretion

negative regulation of long-term synaptic depression

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

regulation of cell communication [inference]

positive regulation of cell communication [inference]

positive regulation of synaptic transmission [inference]

negative regulation of long-term synaptic depression

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

long-term synaptic depression

regulation of long-term synaptic depression [inference]

negative regulation of long-term synaptic depression

negative regulation of synaptic transmission [inference]

long-term synaptic depression

positive regulation of synaptic transmission [inference]

negative regulation of long-term synaptic depression

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of synaptic transmission [inference]

negative regulation of long-term synaptic depression

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of synaptic transmission [inference]

long-term synaptic depression

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

negative regulation of leukocyte migration

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of leukocyte migration

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of nervous system process [inference]

regulation of sensory perception [inference]

regulation of sensory perception of pain

regulation of renal system process [inference]

regulation of glomerular filtration

negative regulation of multicellular organismal process [inference]

negative regulation of mucus secretion

regulation of mucus secretion [inference]

negative regulation of mucus secretion

regulation of biological quality [inference]

regulation of membrane potential [inference]

regulation of postsynaptic membrane potential [inference]

excitatory postsynaptic potential

regulation of synaptic plasticity [inference]

long-term synaptic depression

regulation of long-term synaptic depression [inference]

negative regulation of long-term synaptic depression

regulation of body fluid levels [inference]

body fluid secretion [inference]

mucus secretion

regulation of mucus secretion [inference]

negative regulation of mucus secretion

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
cilium
dendrite	IBA	GO_REF
dendritic spine	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium

neuron projection [inference]

dendrite

neuron spine [inference]

dendritic spine

organelle [inference]

membrane-bounded organelle [inference]

cilium

postsynapse [inference]

dendritic spine

Displaying **all 2** entries
GO Term	Evidence Code	Reference
G protein-coupled adenosine receptor activity	IBA	GO_REF
G protein-coupled adenosine receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled adenosine receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGALVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVTPRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYMVYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPAPPVDEDAPAERPDD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites