GlyCosmos Portal

Submissions

Adenosine receptor A2b

Summary

UniProt ID: P29275
Gene Symbol: ADORA2B
Gene ID: 136
Organism: Homo sapiens (human)

External Links

PubChem: P29275
The Human Metabolome Database: HMDBP01656
Re-Glyco: P29275

Annotation

Keyword: 3D-structure Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Palmitate Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of chronic inflammatory response to non-antigenic stimulus
G protein-coupled receptor signaling pathway	TAS	PMID
G protein-coupled receptor signaling pathway	IEA	GO_REF
adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA	GO_REF
activation of adenylate cyclase activity	TAS	PMID

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte degranulation [inference]

mast cell degranulation

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

multicellular organismal process [inference]

system process [inference]

muscle system process [inference]

relaxation of muscle [inference]

relaxation of smooth muscle [inference]

relaxation of vascular associated smooth muscle

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

vasodilation

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

secretion [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

export from cell [inference]

secretion by cell [inference]

exocytosis [inference]

regulated exocytosis [inference]

leukocyte degranulation [inference]

mast cell degranulation

establishment of localization in cell [inference]

leukocyte degranulation [inference]

mast cell degranulation

establishment of organelle localization [inference]

mast cell degranulation

organelle localization [inference]

establishment of organelle localization [inference]

mast cell degranulation

vacuolar localization [inference]

lysosome localization [inference]

mast cell degranulation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of leukocyte mediated immunity [inference]

regulation of myeloid leukocyte mediated immunity [inference]

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

negative regulation of biological process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of muscle contraction [inference]

negative regulation of smooth muscle contraction [inference]

relaxation of vascular associated smooth muscle

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

regulation of inflammatory response [inference]

regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

regulation of chronic inflammatory response to non-antigenic stimulus [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

positive regulation of response to external stimulus [inference]

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

regulation of inflammatory response [inference]

regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

regulation of chronic inflammatory response to non-antigenic stimulus [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

positive regulation of inflammatory response [inference]

positive regulation of chronic inflammatory response [inference]

positive regulation of chronic inflammatory response to non-antigenic stimulus

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

presynaptic modulation of chemical synaptic transmission

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of regulated secretory pathway [inference]

regulation of leukocyte degranulation [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of mast cell degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of regulated secretory pathway [inference]

positive regulation of leukocyte degranulation [inference]

positive regulation of mast cell degranulation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

regulation of vascular endothelial growth factor production [inference]

positive regulation of vascular endothelial growth factor production

regulation of chemokine production [inference]

positive regulation of chemokine production

regulation of interleukin-6 production [inference]

positive regulation of interleukin-6 production

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of smooth muscle contraction [inference]

negative regulation of smooth muscle contraction [inference]

relaxation of vascular associated smooth muscle

negative regulation of muscle contraction [inference]

negative regulation of smooth muscle contraction [inference]

relaxation of vascular associated smooth muscle

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of muscle contraction [inference]

negative regulation of smooth muscle contraction [inference]

relaxation of vascular associated smooth muscle

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

vasodilation

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

positive regulation of lyase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

positive regulation of lyase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

regulation of adenylate cyclase activity [inference]

positive regulation of adenylate cyclase activity [inference]

activation of adenylate cyclase activity

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IDA	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
Schaffer collateral - CA1 synapse	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

synapse [inference]

presynapse

Displaying **all 2** entries
GO Term	Evidence Code	Reference
G protein-coupled adenosine receptor activity	IBA	GO_REF
G protein-coupled adenosine receptor activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled adenosine receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFAIPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGTRARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMSYMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIVGIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTFHKIISRYLLCQADVKSGNGQAGVQPALGVGL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
153	N-linked (GlcNAc...) asparagine			UniProt
163	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
ADORA2B mediated anti-inflammatory cytokines production	Homo sapiens
Adenosine P1 receptors	Homo sapiens
G alpha (s) signalling events	Homo sapiens
Surfactant metabolism	Homo sapiens

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements