GlyCosmos Portal

Submissions

Rano class II histocompatibility antigen, B-1 beta chain

Summary

UniProt ID

P29826

Gene Symbol

RT1-Bb

Gene ID

[""]

Organism

Rattus norvegicus (Norway rat)

External Links

Re-Glyco: P29826

Annotation

Keyword: 3D-structure Disulfide bond Glycoprotein Isopeptide bond MHC II Reference proteome Signal Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
adaptive immune response
peptide antigen assembly with MHC class II protein complex	IBA	GO_REF
immune response	ISO	GO_REF
immune response	IEA	GO_REF
humoral immune response	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response

antigen processing and presentation

antigen processing and presentation of peptide or polysaccharide antigen via MHC class II [inference]

antigen processing and presentation of peptide antigen via MHC class II [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of exogenous antigen [inference]

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of peptide antigen

antigen processing and presentation of exogenous peptide antigen [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

antigen processing and presentation of peptide antigen via MHC class II [inference]

antigen processing and presentation of exogenous peptide antigen via MHC class II

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to isoquinoline alkaloid [inference]

cellular response to morphine

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

peptide antigen assembly with MHC protein complex [inference]

peptide antigen assembly with MHC class II protein complex

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

peptide antigen assembly with MHC protein complex [inference]

peptide antigen assembly with MHC class II protein complex

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to fungus

immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to isoquinoline alkaloid [inference]

cellular response to morphine

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

response to nitrogen compound [inference]

response to alkaloid [inference]

response to isoquinoline alkaloid [inference]

response to morphine [inference]

cellular response to morphine

cellular response to isoquinoline alkaloid [inference]

cellular response to morphine

cellular response to alkaloid [inference]

cellular response to isoquinoline alkaloid [inference]

cellular response to morphine

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to isoquinoline alkaloid [inference]

cellular response to morphine

response to oxygen-containing compound [inference]

response to ketone [inference]

response to dexamethasone [inference]

cellular response to dexamethasone stimulus

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to lipid [inference]

cellular response to steroid hormone stimulus [inference]

cellular response to corticosteroid stimulus [inference]

cellular response to glucocorticoid stimulus

cellular response to dexamethasone stimulus

cellular response to nitrogen compound [inference]

cellular response to alkaloid [inference]

cellular response to isoquinoline alkaloid [inference]

cellular response to morphine

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to dexamethasone stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of T cell activation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of immune response

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of response to stimulus [inference]

positive regulation of immune response

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

positive regulation of immune response

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

antigen receptor-mediated signaling pathway [inference]

T cell receptor signaling pathway

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of T cell activation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of T cell activation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

positive regulation of multicellular organismal process [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of T cell activation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
lysosomal membrane	IBA	GO_REF
early endosome	ISO	GO_REF
multivesicular body	ISO	GO_REF
Golgi apparatus	ISO	GO_REF
plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

MHC protein complex [inference]

MHC class II protein complex

cellular anatomical structure [inference]

cell surface

membrane

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane [inference]

late endosome membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane [inference]

late endosome membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

late endosome [inference]

multivesicular body

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

late endosome [inference]

multivesicular body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

early endosome

late endosome [inference]

multivesicular body

side of membrane [inference]

external side of plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
MHC class II protein complex binding	IBA	GO_REF
peptide antigen binding	ISO	GO_REF
peptide antigen binding	IBA	GO_REF
protein-containing complex binding	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

antigen binding [inference]

peptide antigen binding

peptide binding [inference]

peptide antigen binding

protein-containing complex binding

MHC protein complex binding [inference]

MHC class II protein complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MALQTPSFLLPAAVVVLMVLSSPGTEGRDSPRDFVYQFKGLCYYTNGTQRIRDVIRYIYNQEEYLRYDSDVGEYRALTELGRPSAEYFNKQYLEQTRAELDTVCRHNYEGSEVRTSLRRLEQPNVAISLSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNGQEETAGVVSTQLIRNGDWTFQILVMLEMTPQRGEVYICHVDHPSLESPVTVEWRAQSESAQSKMLSGIGGFVLGVIFLGLGLFIRHKRQKGPRGPPPAGLLQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
46	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Downstream TCR signaling	Rattus norvegicus
Generation of second messenger molecules	Rattus norvegicus
MHC class II antigen presentation	Rattus norvegicus
PD-1 signaling	Rattus norvegicus
Phosphorylation of CD3 and TCR zeta chains	Rattus norvegicus
Translocation of ZAP-70 to Immunological synapse	Rattus norvegicus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:13141	uveitis	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements