GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Interleukin-4

Summary

UniProt ID

P30367

Gene Symbol

IL4

Gene ID

280824

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P30367
Re-Glyco: P30367

Annotation

Keyword: B-cell activation Cytokine Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 36 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IEA	GO_REF
immune response	IEA	GO_REF
cell surface receptor signaling pathway via JAK-STAT	IEA	GO_REF
negative regulation of epithelial cell migration	IEA	GO_REF
positive regulation of macroautophagy	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

leukocyte activation [inference]

myeloid leukocyte activation [inference]

myeloid dendritic cell activation [inference]

myeloid dendritic cell differentiation

macrophage activation

lymphocyte activation [inference]

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

myeloid dendritic cell activation [inference]

myeloid dendritic cell differentiation

macrophage activation

lymphocyte activation [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-4-mediated signaling pathway

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

myeloid dendritic cell differentiation

mononuclear cell differentiation [inference]

dendritic cell differentiation [inference]

myeloid dendritic cell differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

myeloid dendritic cell differentiation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

myeloid leukocyte activation [inference]

myeloid dendritic cell activation [inference]

myeloid dendritic cell differentiation

macrophage activation

lymphocyte activation [inference]

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

myeloid leukocyte differentiation [inference]

myeloid dendritic cell differentiation

mononuclear cell differentiation [inference]

dendritic cell differentiation [inference]

myeloid dendritic cell differentiation

myeloid cell differentiation [inference]

myeloid leukocyte differentiation [inference]

myeloid dendritic cell differentiation

response to stimulus [inference]

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of leukocyte mediated immunity [inference]

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of lymphocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of B cell mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of immunoglobulin mediated immune response [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

regulation of immune response

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of B cell mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of immunoglobulin mediated immune response [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of type 2 immune response [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

negative regulation of epithelial cell migration

positive regulation of cell migration

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of leukocyte mediated immunity [inference]

positive regulation of lymphocyte mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process [inference]

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of isotype switching [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of endothelial cell apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to transforming growth factor beta stimulus

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial cell migration

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to transforming growth factor beta stimulus

regulation of immune response

regulation of adaptive immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

regulation of T cell mediated immunity [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of B cell mediated immunity [inference]

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of immunoglobulin mediated immune response [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

regulation of type 2 immune response [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of immune response [inference]

positive regulation of adaptive immune response [inference]

positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

positive regulation of T cell mediated immunity [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of B cell mediated immunity [inference]

positive regulation of immunoglobulin mediated immune response [inference]

positive regulation of isotype switching [inference]

positive regulation of type 2 immune response [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of cellular response to transforming growth factor beta stimulus

regulation of cellular response to transforming growth factor beta stimulus [inference]

negative regulation of cellular response to transforming growth factor beta stimulus

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of isotype switching [inference]

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-4-mediated signaling pathway

cell surface receptor signaling pathway via STAT [inference]

cell surface receptor signaling pathway via JAK-STAT

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-13 production [inference]

positive regulation of interleukin-13 production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of MHC class II biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process [inference]

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy

regulation of autophagy [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy

regulation of macroautophagy [inference]

positive regulation of macroautophagy

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-13 production [inference]

positive regulation of interleukin-13 production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of MHC class II biosynthetic process [inference]

positive regulation of MHC class II biosynthetic process

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process [inference]

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of DNA metabolic process [inference]

regulation of DNA recombination [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of DNA metabolic process [inference]

regulation of DNA recombination [inference]

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

positive regulation of DNA metabolic process [inference]

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

regulation of cell killing [inference]

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

regulation of complement-dependent cytotoxicity [inference]

negative regulation of complement-dependent cytotoxicity

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of endothelial cell apoptotic process

regulation of endothelial cell apoptotic process [inference]

negative regulation of endothelial cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of endothelial cell apoptotic process

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of catabolic process [inference]

positive regulation of autophagy [inference]

positive regulation of macroautophagy

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production [inference]

positive regulation of isotype switching [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of MHC class II biosynthetic process

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of DNA metabolic process [inference]

positive regulation of DNA recombination [inference]

positive regulation of isotype switching [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell killing [inference]

negative regulation of complement-dependent cytotoxicity

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of endothelial cell apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

negative regulation of epithelial cell migration

positive regulation of cell migration

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of epithelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of cytokine production involved in immune response [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T cell cytokine production [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of T-helper 2 cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

regulation of interleukin-10 production [inference]

positive regulation of interleukin-10 production

regulation of interleukin-13 production [inference]

positive regulation of interleukin-13 production

regulation of epithelial cell migration [inference]

negative regulation of epithelial cell migration

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

regulation of lymphocyte proliferation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

regulation of B cell activation [inference]

regulation of B cell proliferation [inference]

positive regulation of B cell proliferation

regulation of isotype switching [inference]

positive regulation of isotype switching [inference]

regulation of isotype switching to IgE isotypes [inference]

positive regulation of isotype switching to IgE isotypes

regulation of isotype switching to IgG isotypes [inference]

positive regulation of isotype switching to IgG isotypes

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of cytokine production involved in immune response [inference]

positive regulation of T cell cytokine production [inference]

positive regulation of T-helper 2 cell cytokine production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell activation [inference]

positive regulation of B cell activation [inference]

positive regulation of B cell proliferation

positive regulation of isotype switching [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial cell migration

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

regulation of lymphocyte differentiation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell differentiation

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine activity	IEA	GO_REF
interleukin-4 receptor binding	IEA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-4 receptor binding

growth factor receptor binding [inference]

interleukin-4 receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
62	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Interleukin-4 and Interleukin-13 signaling	Bos taurus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026