GlyCosmos Portal

Submissions

CD9 antigen

Summary

UniProt ID

P30932

Gene Symbol

Gene ID

280746

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P30932
Re-Glyco: P30932

Annotation

Keyword: Cell adhesion Cell membrane Disulfide bond Fertilization Glycoprotein Palmitate Reference proteome Secreted Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cell adhesion	ISS	GO_REF
single fertilization	ISS	GO_REF
fusion of sperm to egg plasma membrane involved in single fertilization	ISS	GO_REF
negative regulation of cell population proliferation	ISS	GO_REF
myoblast fusion involved in skeletal muscle regeneration	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

cell recognition [inference]

cell-cell recognition [inference]

sperm-egg recognition

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

cellular response to stimulus [inference]

cellular response to lipoprotein particle stimulus [inference]

cellular response to low-density lipoprotein particle stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cellular component assembly involved in morphogenesis [inference]

paranodal junction assembly

cell junction assembly [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

cell junction organization [inference]

cell junction assembly [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

cell-cell junction organization [inference]

cell-cell junction assembly [inference]

paranodal junction assembly

cell-cell fusion [inference]

syncytium formation by cell-cell fusion [inference]

myoblast fusion [inference]

myoblast fusion involved in skeletal muscle regeneration

reproductive process [inference]

fertilization [inference]

single fertilization

multicellular organismal reproductive process [inference]

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

cellular component assembly involved in morphogenesis [inference]

paranodal junction assembly

response to stimulus [inference]

response to endogenous stimulus [inference]

response to lipoprotein particle [inference]

cellular response to low-density lipoprotein particle stimulus

response to chemical [inference]

response to lipoprotein particle [inference]

cellular response to low-density lipoprotein particle stimulus

cellular response to stimulus [inference]

cellular response to lipoprotein particle stimulus [inference]

cellular response to low-density lipoprotein particle stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion [inference]

negative regulation of platelet aggregation

negative regulation of cell population proliferation

negative regulation of cell activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of cell activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of cellular process [inference]

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion [inference]

negative regulation of platelet aggregation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion [inference]

negative regulation of platelet aggregation

regulation of homotypic cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion [inference]

negative regulation of platelet aggregation

regulation of platelet aggregation [inference]

negative regulation of platelet aggregation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of homotypic cell-cell adhesion [inference]

negative regulation of platelet aggregation

negative regulation of cell population proliferation

negative regulation of cell activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of cell activation [inference]

regulation of platelet activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of platelet aggregation [inference]

negative regulation of platelet aggregation

negative regulation of cell activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of cell activation [inference]

regulation of platelet activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of platelet aggregation [inference]

negative regulation of platelet aggregation

negative regulation of cell activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of cell activation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

regulation of biological quality [inference]

regulation of body fluid levels [inference]

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

negative regulation of platelet activation [inference]

negative regulation of platelet aggregation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF
membrane	ISS	GO_REF
membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

Displaying **all 2** entries
GO Term	Evidence Code	Reference
integrin binding	ISS	GO_REF
integrin binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

cell adhesion molecule binding [inference]

integrin binding

protein-containing complex binding [inference]

integrin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPVKGGTKCIKYLLFGFNFIFWLAGIAVLSVGLWLRFDSQTKSIFEQENNDSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFSFLLVIFAIEVAAAIWGYSHKEEVIKEVQKFYEDTYNKLKNKDEPQRETLKAIHIALDCCGLTGVPEQFLTDTCPPKNLIDSLKTRPCPEAIDEIFRSKFHIIGAVGIGIAVVMIFGMVFSMILCCAIRRNRDMV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites