GlyCosmos Portal

Submissions

Osteopontin

Summary

UniProt ID: P31096
Gene Symbol: OPN SPP1
Gene ID: 281499
Organism: Bos taurus (domestic cattle)

External Links

PubChem: P31096
Re-Glyco: P31096

Annotation

Keyword: Biomineralization Cell adhesion Cytokine Direct protein sequencing Phosphoprotein Proteoglycan Reference proteome Secreted Sialic acid Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
osteoblast differentiation
cell adhesion	IBA	GO_REF
cell adhesion	IEA	GO_REF
biomineral tissue development
positive regulation of bone resorption

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

cellular developmental process [inference]

cell differentiation [inference]

osteoblast differentiation

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

biomineral tissue development

cellular developmental process [inference]

cell differentiation [inference]

osteoblast differentiation

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of bone resorption

regulation of multicellular organismal process [inference]

regulation of tissue remodeling [inference]

regulation of bone remodeling [inference]

regulation of bone resorption [inference]

positive regulation of bone resorption

positive regulation of multicellular organismal process [inference]

positive regulation of bone resorption

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	TAS	Reactome
extracellular region	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying **all 4** entries
GO Term	Evidence Code	Reference
cytokine activity
integrin binding	ISS	GO_REF
integrin binding	IBA	GO_REF
extracellular matrix binding

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

cell adhesion molecule binding [inference]

integrin binding

protein-containing complex binding [inference]

integrin binding

extracellular matrix binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Site Annotations

Displaying **all 3** entries
Position	Description
79	Not glycosylated
101	Not glycosylated
209	Not glycosylated

Annotation information from UniProt.

Sequence

MRIAVICFCLLGIASALPVKPTSSGSSEEKQLNNKYPDAVATWLKPDPSQKQTFLAPQNSVSSEETDDNKQNTLPSKSNESPEQTDDLDDDDDNSQDVNSNDSDDAETTDDPDHSDESHHSDESDEVDFPTDIPTIAVFTPFIPTESANDGRGDSVAYGLKSRSKKFRRSNVQSPDATEEDFTSHIESEEMHDAPKKTSQLTDHSKETNSSELSKELTPKAKDKNKHSNLIESQENSKLSQEFHSLEDKLDLDHKSEEDKHLKIRISHELDSASSEVN

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 5** entries
Position	Description	Source
131	O-linked (GalNAc...) threonine	UniProt
140	O-linked (GalNAc...) threonine	UniProt
145	O-linked (GalNAc...) threonine	UniProt
205	O-linked (Xyl...) (chondroitin sulfate) serine	UniProt
272	O-linked (Xyl...) (chondroitin sulfate) serine	UniProt