Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Cytokine receptor common subunit gamma
Summary
- UniProt ID
- P31785
- Gene Symbol
-
- IL2RG
- Gene ID
- 3561
- Organism
- Homo sapiens (human)
Annotation
- Keyword
- 3D-structure Alternative splicing Cell membrane Direct protein sequencing Disease variant Disulfide bond Glycoprotein Host-virus interaction Phosphoprotein Proteomics identification Receptor Reference proteome SCID Signal Transmembrane helix
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| mature B cell differentiation |
|
|
| CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation |
|
|
| positive regulation of immunoglobulin production |
|
|
| immune response | ||
| signal transduction |
GO Hierarchy
biological process
immune system process [inference]
cellular process [inference]
multicellular organismal process [inference]
developmental process [inference]
biological regulation [inference]
regulation of biological process [inference]
regulation of immune system process [inference]
positive regulation of immune system process [inference]
regulation of leukocyte activation [inference]
positive regulation of leukocyte activation [inference]
regulation of lymphocyte activation [inference]
regulation of lymphocyte differentiation [inference]
regulation of T cell activation [inference]
positive regulation of lymphocyte activation [inference]
regulation of hemopoiesis [inference]
positive regulation of biological process [inference]
positive regulation of immune system process [inference]
positive regulation of cellular process [inference]
positive regulation of cell differentiation [inference]
positive regulation of cell adhesion [inference]
positive regulation of cell activation [inference]
positive regulation of developmental process [inference]
positive regulation of multicellular organismal process [inference]
regulation of developmental process [inference]
regulation of cell differentiation [inference]
positive regulation of cell differentiation [inference]
regulation of cell development [inference]
positive regulation of developmental process [inference]
regulation of multicellular organismal development [inference]
regulation of cellular process [inference]
regulation of metabolic process [inference]
regulation of cell adhesion [inference]
regulation of cell differentiation [inference]
positive regulation of cell differentiation [inference]
regulation of cell development [inference]
positive regulation of cellular process [inference]
positive regulation of cell differentiation [inference]
positive regulation of cell adhesion [inference]
positive regulation of cell activation [inference]
regulation of cell activation [inference]
regulation of leukocyte activation [inference]
positive regulation of leukocyte activation [inference]
regulation of lymphocyte activation [inference]
regulation of lymphocyte differentiation [inference]
regulation of T cell activation [inference]
positive regulation of lymphocyte activation [inference]
positive regulation of cell activation [inference]
regulation of multicellular organismal process [inference]
regulation of cell activation [inference]
regulation of leukocyte activation [inference]
positive regulation of leukocyte activation [inference]
regulation of lymphocyte activation [inference]
regulation of lymphocyte differentiation [inference]
regulation of T cell activation [inference]
positive regulation of lymphocyte activation [inference]
positive regulation of cell activation [inference]
positive regulation of multicellular organismal process [inference]
regulation of multicellular organismal development [inference]
| GO Term | Evidence Code | Reference |
|---|---|---|
| nucleoplasm |
|
|
| endosome | ||
| cytosol | ||
| plasma membrane | ||
| plasma membrane |
|
GO Hierarchy
| GO Term | Evidence Code | Reference |
|---|---|---|
| cytokine receptor activity | ||
| cytokine receptor activity | ||
| coreceptor activity | ||
| cytokine binding | ||
| interleukin-2 binding |
GO Hierarchy
Sequence
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 24 |
|
|
||
| 66 |
|
|
||
| 71 |
|
|
||
| 75 |
|
|
||
| 84 |
|
|
||
| 159 |
|
|
||
| 180 |
|
|
||
| 249 |
|
|
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| Interleukin receptor SHC signaling | Homo sapiens |
| Interleukin-15 signaling | Homo sapiens |
| Interleukin-2 signaling | Homo sapiens |
| Interleukin-21 signaling | Homo sapiens |
| Interleukin-4 and Interleukin-13 signaling | Homo sapiens |
| Interleukin-7 signaling | Homo sapiens |
| Interleukin-9 signaling | Homo sapiens |
| RAF/MAP kinase cascade | Homo sapiens |
| STAT3 nuclear events downstream of ALK signaling | Homo sapiens |
Human Protein Atlas
Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.
Disease
| DO ID | Disease Name | Source |
|---|---|---|
| DOID:0060013 | X-linked severe combined immunodeficiency | |
| DOID:627 | severe combined immunodeficiency | |
| DOID:628 | combined T cell and B cell immunodeficiency |
