GlyCosmos Portal

Submissions

Opioid-binding protein/cell adhesion molecule

Summary

UniProt ID: P32736
Gene Symbol: Obcam Opcml
Gene ID: 116597
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P32736
PubChem: P32736
RaftProt: P32736
Re-Glyco: P32736

Annotation

Keyword: Alternative splicing Cell adhesion Cell membrane Direct protein sequencing Disulfide bond GPI-anchor Immunoglobulin domain Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
cell adhesion
positive regulation of cell size	IDA	PMID
positive regulation of synapse assembly	IDA	PMID
negative regulation of glial cell proliferation	IDA	PMID
negative regulation of glial cell proliferation	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

cellular component organization or biogenesis [inference]

cellular component organization [inference]

regulation of cellular component size [inference]

regulation of cell size [inference]

positive regulation of cell size

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

positive regulation of cellular component organization [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

positive regulation of developmental process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of glial cell proliferation

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

positive regulation of developmental process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

regulation of cellular process [inference]

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of glial cell proliferation

regulation of glial cell proliferation [inference]

negative regulation of glial cell proliferation

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

positive regulation of synapse assembly

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

positive regulation of cellular component organization [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of glial cell proliferation

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of synapse assembly [inference]

positive regulation of synapse assembly

positive regulation of cellular component organization [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

positive regulation of synapse assembly

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

negative regulation of multicellular organismal process [inference]

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell proliferation

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of cellular component size [inference]

regulation of cell size [inference]

positive regulation of cell size

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF
postsynaptic density	IDA	PMID
postsynaptic density	IBA	GO_REF
neuronal cell body	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite [inference]

apical dendrite

neuron spine [inference]

dendritic spine

organelle [inference]

postsynaptic specialization [inference]

postsynaptic density

cell body [inference]

neuronal cell body

side of membrane

postsynapse [inference]

dendritic spine

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEISSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTFFAHFFIKF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
44	N-linked (GlcNAc...) asparagine	18729387 34106099	G76285RN G67324HN	UniProt GlyGen
70	N-linked (GlcNAc...) asparagine	18729387	G43947VZ	UniProt GlyGen
140	N-linked (GlcNAc...) asparagine			UniProt GlyGen
285	N-linked (GlcNAc...) asparagine	18729387	G54652ZD	UniProt GlyGen
293	N-linked (GlcNAc...) asparagine	18729387 34106099	G81572SC G19379ID G70258ML G88725PI	UniProt GlyGen
306	N-linked (GlcNAc...) asparagine			UniProt GlyGen