GlyCosmos Portal

Submissions

72 kDa type IV collagenase

Summary

UniProt ID: P33434
Gene Symbol: Mmp2
Gene ID: 17390
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003572
PubChem: P33434
Re-Glyco: P33434

Annotation

Keyword: Alternative splicing Angiogenesis Autocatalytic cleavage Calcium Collagen degradation Cytoplasm Disulfide bond Extracellular matrix Glycoprotein Membrane Metal-binding Metalloprotease Mitochondrion Nucleus Phosphoprotein Reference proteome Repeat Signal Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 82 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	IEA	GO_REF
ovarian follicle development	ISO	GO_REF
ovarian follicle development	IEA	GO_REF
ovulation from ovarian follicle	IEA	GO_REF
luteinization	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

mononuclear cell migration [inference]

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

macrophage migration [inference]

macrophage chemotaxis

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

collagen catabolic process

collagen metabolic process [inference]

collagen catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

primary metabolic process [inference]

protein metabolic process [inference]

cellular developmental process [inference]

cell differentiation [inference]

endodermal cell differentiation

cell motility [inference]

cell migration

ameboidal-type cell migration [inference]

trophoblast cell migration

leukocyte migration [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

mononuclear cell migration [inference]

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

macrophage migration [inference]

macrophage chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

cellular response to stimulus [inference]

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration [inference]

peripheral nervous system axon regeneration

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species

cellular response to fluid shear stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to lipid [inference]

cellular response to estradiol stimulus

cellular response to oxygen-containing compound [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection regeneration [inference]

axon regeneration [inference]

peripheral nervous system axon regeneration

axon development [inference]

axon regeneration [inference]

peripheral nervous system axon regeneration

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

reproductive process [inference]

developmental process involved in reproduction [inference]

prostate gland epithelium morphogenesis

embryo implantation

ovulation cycle process [inference]

multi-organism reproductive process [inference]

parturition

multicellular organismal reproductive process [inference]

ovulation [inference]

ovulation from ovarian follicle

multicellular organismal process [inference]

ossification [inference]

direct ossification [inference]

intramembranous ossification

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

negative regulation of vasoconstriction

multi-multicellular organism process [inference]

parturition

tissue remodeling

developmental process [inference]

developmental process involved in reproduction [inference]

prostate gland epithelium morphogenesis

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

skeletal system morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

prostate gland epithelium morphogenesis

face morphogenesis

developmental maturation [inference]

anatomical structure maturation [inference]

blood vessel maturation

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

trabecula formation [inference]

bone trabecula formation

anatomical structure development [inference]

ovarian follicle development

regeneration [inference]

neuron projection regeneration [inference]

axon regeneration [inference]

peripheral nervous system axon regeneration

animal organ development [inference]

heart development

cellular developmental process [inference]

cell differentiation [inference]

endodermal cell differentiation

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

rhythmic process [inference]

ovulation cycle process [inference]

response to stimulus [inference]

response to stress [inference]

response to hypoxia

response to oxidative stress

response to reactive oxygen species [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species

response to wounding [inference]

response to axon injury [inference]

axon regeneration [inference]

peripheral nervous system axon regeneration

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration [inference]

peripheral nervous system axon regeneration

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species

cellular response to fluid shear stress

response to fluid shear stress [inference]

cellular response to fluid shear stress

response to hyperoxia

response to external stimulus [inference]

response to mechanical stimulus

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

response to UV [inference]

cellular response to UV [inference]

cellular response to UV-A

response to UV-A [inference]

cellular response to UV-A

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

response to increased oxygen levels [inference]

response to hyperoxia

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

response to endogenous stimulus [inference]

response to hormone [inference]

response to estrogen

response to activity

response to chemical [inference]

response to acid chemical [inference]

response to amino acid [inference]

cellular response to amino acid stimulus

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

response to xenobiotic stimulus

response to hormone [inference]

response to estrogen

response to lipid [inference]

response to estradiol [inference]

cellular response to estradiol stimulus

response to retinoic acid

cellular response to lipid [inference]

cellular response to estradiol stimulus

response to nicotine

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to lipid [inference]

cellular response to estradiol stimulus

cellular response to oxygen-containing compound [inference]

response to peptide [inference]

response to cytokine [inference]

response to interleukin-1 [inference]

cellular response to interleukin-1

cellular response to cytokine stimulus [inference]

cellular response to interleukin-1

response to nitrogen compound [inference]

response to amyloid-beta

response to oxygen-containing compound [inference]

response to reactive oxygen species [inference]

response to estradiol [inference]

cellular response to estradiol stimulus

response to retinoic acid

cellular response to oxygen-containing compound [inference]

response to amyloid-beta

cellular response to stimulus [inference]

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration [inference]

peripheral nervous system axon regeneration

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species

cellular response to fluid shear stress

cellular response to chemical stimulus [inference]

cellular response to chemical stress [inference]

cellular response to oxidative stress [inference]

cellular response to reactive oxygen species

cellular response to acid chemical [inference]

cellular response to amino acid stimulus

cellular response to lipid [inference]

cellular response to estradiol stimulus

cellular response to oxygen-containing compound [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of innate immune response

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cell adhesion

negative regulation of multicellular organismal process [inference]

negative regulation of vasoconstriction

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response

regulation of innate immune response [inference]

positive regulation of innate immune response

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response

regulation of innate immune response [inference]

positive regulation of innate immune response

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of defense response [inference]

positive regulation of innate immune response

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

regulation of immune response [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response

positive regulation of immune response [inference]

positive regulation of innate immune response

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response

regulation of innate immune response [inference]

positive regulation of innate immune response

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of cell adhesion [inference]

negative regulation of cell adhesion

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of neuron apoptotic process [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of apoptotic signaling pathway [inference]

positive regulation of intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway [inference]

positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway

positive regulation of cell motility [inference]

positive regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of vasoconstriction [inference]

negative regulation of vasoconstriction

negative regulation of multicellular organismal process [inference]

negative regulation of vasoconstriction

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

negative regulation of vasoconstriction

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleus	IEA	GO_REF
cytoplasm	IDA	PMID
cytoplasm	IEA	GO_REF
mitochondrion	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

sarcomere

external encapsulating structure [inference]

extracellular matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
fibronectin binding	ISO	GO_REF
fibronectin binding	IEA	GO_REF
endopeptidase activity	ISO	GO_REF
endopeptidase activity	IEA	GO_REF
metalloendopeptidase activity	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity

endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

metallopeptidase activity

metalloendopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity

endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

metallopeptidase activity

metalloendopeptidase activity

binding [inference]

protein binding [inference]

fibronectin binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEARVAWGALAGPLRVLCVLCCLLGRAIAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
303		GlycoProtDB
575	N-linked (GlcNAc...) asparagine	UniProt
644	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Activation of Matrix Metalloproteinases	Mus musculus
Collagen degradation	Mus musculus
Degradation of the extracellular matrix	Mus musculus
EPH-ephrin mediated repulsion of cells	Mus musculus
Extra-nuclear estrogen signaling	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements