GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Accessory gland-specific peptide 26Aa

Summary

UniProt ID: P33737
Gene Symbol: Acp26Aa Mst26Aa mst355a
Gene ID
Organism: Drosophila simulans

External Links

Re-Glyco: P33737

Annotation

Keyword: Behavior Glycoprotein Secreted Signal

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
mating	IEA	GO_REF GO_REF
positive regulation of ovulation	IEA	GO_REF
positive regulation of octopamine signaling pathway	IEA	GO_REF

GO Hierarchy

biological process

reproductive process [inference]

multi-organism reproductive process [inference]

mating

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of octopamine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of ovulation

positive regulation of reproductive process [inference]

positive regulation of ovulation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of octopamine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of octopamine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of G protein-coupled receptor signaling pathway [inference]

positive regulation of octopamine or tyramine signaling pathway [inference]

positive regulation of octopamine signaling pathway

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of ovulation

regulation of ovulation [inference]

positive regulation of ovulation

regulation of reproductive process [inference]

regulation of ovulation [inference]

positive regulation of ovulation

positive regulation of reproductive process [inference]

positive regulation of ovulation

Displaying 1 entry
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying 1 entry
GO Term	Evidence Code	Reference
identical protein binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNQILLCSQILLLLFAVANCDGEHQLDSSMDLKSDSTKSAVLKNVAPKNDATQAEIAKDDVALKSGKKGDYVMDIDVCTMPLDDYPINNSKSRKNSSTLPSQILTDKPNQGSNQIALKALKHRLLMEQNNNLFLRNHSVSLMNEIEARKTDIIQARQLNIDLELELEALKRKLSEMNAQNARKPTKSCKKRPSKDIAPPANQLQEVIVKNTYRNKYLTLLTQLAQKINYEIANVNNPATDVPTGKSPSEGNPSTT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
88	N-linked (GlcNAc...) asparagine			UniProt
95	N-linked (GlcNAc...) asparagine			UniProt
136	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026