GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Syndecan-4

Summary

UniProt ID: P34901
Gene Symbol: Sdc4 Synd4
Gene ID: 24771
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P34901
PubChem: P34901
Re-Glyco: P34901

Annotation

Keyword: 3D-structure Direct protein sequencing Heparan sulfate Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
ureteric bud development	IEP	PMID
neural tube closure	ISO	GO_REF
cell adhesion	NAS	PMID
cell-cell signaling	NAS	PMID
regulation of fibroblast migration	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling

cell adhesion

cell motility [inference]

cell migration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

inner ear receptor cell stereocilium organization

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

tube formation [inference]

tube closure [inference]

neural tube closure

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

tissue development [inference]

epithelium development [inference]

kidney epithelium development [inference]

mesonephric epithelium development [inference]

mesonephric tubule development [inference]

ureteric bud development

tube development [inference]

mesonephric tubule development [inference]

ureteric bud development

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

wound healing

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

signaling [inference]

cell-cell signaling

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of exosomal secretion

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular process [inference]

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of cellular component biogenesis [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of exosomal secretion

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of organelle assembly [inference]

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

regulation of extracellular exosome assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of exosomal secretion

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of organelle assembly [inference]

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

regulation of extracellular exosome assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of cell-substrate junction organization [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	IEA	GO_REF
plasma membrane	TAS	Reactome
focal adhesion	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

cell junction [inference]

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

costamere

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
fibronectin binding	IDA	PMID
protein kinase C binding	IDA	PMID
identical protein binding	ISO	GO_REF
identical protein binding	IPI	PMID PMID
identical protein binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

fibronectin binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein kinase C binding

identical protein binding

molecular transducer activity [inference]

signaling receptor activity [inference]

thrombospondin receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPVCLFAPLLLLLLGGFPVAPGESIRETEVIDPQDLLEGRYFSGALPDDEDAGGLEQDSDFELSGSGDLDDTEEPRTFPEVISPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRVPSDVGDDDVSNKVSMSSTSQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
44	O-linked (Xyl...) (glycosaminoglycan) serine	7520439		UniProt GlyGen
65	O-linked (Xyl...) (glycosaminoglycan) serine	7520439		UniProt GlyGen
67	O-linked (Xyl...) (glycosaminoglycan) serine	7520439		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Glycosaminoglycan-protein linkage region biosynthesis	Rattus norvegicus
HS-GAG biosynthesis	Rattus norvegicus
HS-GAG degradation	Rattus norvegicus
Regulation of clotting cascade	Rattus norvegicus
Retinoid metabolism and transport	Rattus norvegicus
Syndecan interactions	Rattus norvegicus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:104	bacterial infectious disease	Alliance of Genome Resources

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026