GlyCosmos Portal

Submissions

Pulmonary surfactant-associated protein D

Summary

UniProt ID: P35248
Gene Symbol: Sftp4 Sftpd
Gene ID: 25350
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P35248
Re-Glyco: P35248

Annotation

Keyword: Calcium Coiled coil Collagen Direct protein sequencing Disulfide bond Extracellular matrix Glycoprotein Hydroxylation Innate immunity Lectin Phosphoprotein Reference proteome Repeat S-nitrosylation Signal Surface film

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
respiratory gaseous exchange by respiratory system
opsonization	IDA	PMID
negative regulation of interleukin-2 production	IDA	PMID
negative regulation of T cell proliferation	IDA	PMID
surfactant homeostasis	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

opsonization

immune response [inference]

innate immune response

multicellular organismal process [inference]

respiratory gaseous exchange by respiratory system

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

developmental process [inference]

anatomical structure development [inference]

lung alveolus development

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

chemical homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to hyperoxia

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to increased oxygen levels [inference]

response to hyperoxia

response to endogenous stimulus [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to growth factor

response to chemical [inference]

response to hormone [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

response to lipid [inference]

response to steroid hormone [inference]

response to corticosteroid [inference]

response to glucocorticoid

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of localization [inference]

regulation of transport [inference]

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of transport [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

positive regulation of transport [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

negative regulation of transport [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular component organization [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

negative regulation of cellular component organization [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of cellular component organization [inference]

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of vesicle-mediated transport [inference]

regulation of endocytosis [inference]

negative regulation of endocytosis [inference]

negative regulation of phagocytosis

positive regulation of endocytosis [inference]

positive regulation of phagocytosis

regulation of phagocytosis [inference]

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

regulation of interleukin-2 production [inference]

negative regulation of interleukin-2 production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-2 production

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
collagen trimer
obsolete extracellular space
cytoplasm	ISO	GO_REF
cytoplasm	IEA	GO_REF
multivesicular body	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

collagen trimer

cellular anatomical structure [inference]

cytoplasm

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

late endosome [inference]

multivesicular body

Displaying **all 5** entries
GO Term	Evidence Code	Reference
lipopolysaccharide binding	IDA	PMID
identical protein binding	ISO	GO_REF
identical protein binding	IDA	PMID
identical protein binding	IPI	PMID
monosaccharide binding	IDA	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

lipid binding [inference]

lipopolysaccharide binding

carbohydrate binding [inference]

monosaccharide binding

small molecule binding [inference]

monosaccharide binding

carbohydrate derivative binding [inference]

lipopolysaccharide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLHFLSMLVLLVQPLGDLGAEMKTLSQRSITNTCTLVLCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLPGPRGPVGPKGENGSAGEPGPKGERGLVGPPGSPGISGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGAKGPAGPKGERGAPGEQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGAPGDRGIKGESGLPDSAALRQQMEALNGKLQRLEAAFSRYKKAALFPDGQSVGDKIFRAANSEEPFEDAKEMCRQAGGQLASPRSATENAAVQQLVTAHSKAAFLSMTDVGTEGKFTYPTGEALVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
89	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Regulation of TLR by endogenous ligand	Rattus norvegicus
Signal regulatory protein family interactions	Rattus norvegicus
Surfactant metabolism	Rattus norvegicus
Toll Like Receptor 4 (TLR4) Cascade	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements