GlyCosmos Portal

Submissions

Ras-related protein Rab-21

Summary

UniProt ID: P35282
Gene Symbol: Rab21
Gene ID: 216344
Organism: Mus musculus (house mouse)

External Links

GlyGen: P35282
PubChem: P35282
RaftProt: P35282
Re-Glyco: P35282

Annotation

Keyword: Acetylation Cell projection Cytoplasmic vesicle Direct protein sequencing Endoplasmic reticulum Endosome GTP-binding Golgi apparatus Hydrolase Magnesium Membrane Metal-binding Methylation Prenylation Protein transport Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
intracellular protein transport
anterograde axonal transport	ISO	GO_REF GO_REF
anterograde axonal transport	IEA	GO_REF
regulation of exocytosis	ISO	GO_REF
regulation of exocytosis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule-based movement [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rab protein signal transduction

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport

establishment of localization [inference]

transport [inference]

protein transport [inference]

intracellular protein transport

intracellular transport [inference]

intracellular protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport

microtubule-based transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

cytoskeleton-dependent intracellular transport [inference]

transport along microtubule [inference]

axo-dendritic transport [inference]

axonal transport [inference]

anterograde axonal transport

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of intracellular transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of early endosome to late endosome transport

regulation of early endosome to late endosome transport [inference]

positive regulation of early endosome to late endosome transport

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of exocytosis

positive regulation of transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of early endosome to late endosome transport

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of vesicle-mediated transport [inference]

regulation of exocytosis

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of early endosome to late endosome transport [inference]

positive regulation of early endosome to late endosome transport

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of early endosome to late endosome transport

regulation of early endosome to late endosome transport [inference]

positive regulation of early endosome to late endosome transport

regulation of growth [inference]

regulation of cell growth [inference]

regulation of extent of cell growth [inference]

regulation of axon extension

regulation of developmental growth [inference]

regulation of axon extension

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of intracellular transport [inference]

positive regulation of early endosome to late endosome transport

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of dendrite morphogenesis

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

positive regulation of transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of early endosome to late endosome transport

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of dendrite morphogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of developmental growth [inference]

regulation of axon extension

regulation of dendrite development [inference]

regulation of dendrite morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rab protein signal transduction

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of cellular process [inference]

positive regulation of intracellular transport [inference]

positive regulation of early endosome to late endosome transport

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of cell morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of dendrite morphogenesis

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of cellular component organization [inference]

regulation of cell growth [inference]

regulation of extent of cell growth [inference]

regulation of axon extension

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of dendrite morphogenesis

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

regulation of dendrite development [inference]

regulation of dendrite morphogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of cellular component organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of dendrite morphogenesis

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of early endosome to late endosome transport

regulation of early endosome to late endosome transport [inference]

positive regulation of early endosome to late endosome transport

regulation of vesicle-mediated transport [inference]

regulation of exocytosis

regulation of endocytosis [inference]

positive regulation of endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of receptor-mediated endocytosis [inference]

positive regulation of receptor-mediated endocytosis

regulation of early endosome to late endosome transport [inference]

positive regulation of early endosome to late endosome transport

regulation of secretion by cell [inference]

regulation of exocytosis

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of dendrite morphogenesis

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 28 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	EXP	PMID
Golgi membrane	IEA	GO_REF
endosome	ISO	GO_REF
endosome	IEA	GO_REF
early endosome	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm [inference]

neuron projection cytoplasm [inference]

axon cytoplasm

endomembrane system

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

plasma membrane region [inference]

cleavage furrow

cell junction [inference]

synapse

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

trans-Golgi network

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

early endosome

side of membrane [inference]

cytoplasmic side of membrane [inference]

cytoplasmic side of plasma membrane

cytoplasmic side of endosome membrane [inference]

cytoplasmic side of early endosome membrane

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	ISS	GO_REF
GTPase activity	ISO	GO_REF
GTPase activity	IEA	GO_REF GO_REF
G protein activity	ISS	GO_REF
G protein activity	ISO	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

G protein activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

GDP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

molecular function regulator activity [inference]

G protein activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAAGGGAAAAAGRAYSFKVVLLGEGCVGKTSLVLRYCENKFNDKHITTLQASFLTKKLNIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDLEKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCCSSG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites