GlyCosmos Portal

Submissions

ATP synthase F(1) complex subunit delta, mitochondrial

Summary

UniProt ID: P35434
Gene Symbol: Atp5d Atp5f1d
Gene ID: 245965
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: P35434
PubChem: P35434
The O-GlcNAc Database: P35434
O-GlcNAcAtlas: P35434
Re-Glyco: P35434

Annotation

Keyword: Acetylation CF(1) Direct protein sequencing Hydrogen ion transport Mitochondrion inner membrane Reference proteome Transit peptide

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
aerobic respiration	ISS	GO_REF
aerobic respiration	ISO	GO_REF
proton motive force-driven ATP synthesis	IBA	GO_REF
proton motive force-driven ATP synthesis	IEA	GO_REF
mitochondrial proton-transporting ATP synthase complex assembly	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

cellular respiration [inference]

aerobic respiration

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

biosynthetic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ATP metabolic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process [inference]

proton motive force-driven ATP synthesis

proton motive force-driven mitochondrial ATP synthesis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

protein-containing complex assembly [inference]

mitochondrial respiratory chain complex assembly [inference]

mitochondrial proton-transporting ATP synthase complex assembly

proton-transporting two-sector ATPase complex assembly [inference]

proton-transporting ATP synthase complex assembly [inference]

mitochondrial proton-transporting ATP synthase complex assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

mitochondrial respiratory chain complex assembly [inference]

mitochondrial proton-transporting ATP synthase complex assembly

proton-transporting two-sector ATPase complex assembly [inference]

proton-transporting ATP synthase complex assembly [inference]

mitochondrial proton-transporting ATP synthase complex assembly

response to stimulus [inference]

response to chemical [inference]

response to stilbenoid [inference]

response to resveratrol

response to oxygen-containing compound [inference]

response to resveratrol

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISO	GO_REF
mitochondrion	IEA	GO_REF GO_REF
mitochondrial inner membrane	IDA	PMID
mitochondrial inner membrane	IEA	GO_REF
proton-transporting ATP synthase complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

proton-transporting two-sector ATPase complex [inference]

proton-transporting ATP synthase complex

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

cation channel complex [inference]

proton-transporting ATP synthase complex

respiratory chain complex [inference]

proton-transporting ATP synthase complex

catalytic complex [inference]

proton-transporting ATP synthase complex

transporter complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

cation channel complex [inference]

proton-transporting ATP synthase complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
structural molecule activity	ISS	GO_REF
structural molecule activity	ISO	GO_REF
protein-containing complex binding	IDA	PMID
proton-transporting ATP synthase activity, rotational mechanism	ISO	GO_REF
proton-transporting ATP synthase activity, rotational mechanism	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

ligase activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

structural molecule activity

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

proton transmembrane transporter activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

proton channel activity [inference]

proton-transporting ATP synthase activity, rotational mechanism

binding [inference]

protein-containing complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MLPAALLRHPGLRRLVLQARTYAQAAASPAPAAGPGQMSFTFASPTQVFFDGANVRQVDVPTLTGAFGILASHVPTLQVLRPGLVMVHAEDGTTTKYFVSSGSVTVNADSSVQLLAEEVVTLDMLDLGAARANLEKAQSELSGAADEAARAEIQIRIEANEALVKALE

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
139		26446791	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Cristae formation	Rattus norvegicus
Formation of ATP by chemiosmotic coupling	Rattus norvegicus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:9970	obesity	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements