GlyCosmos Portal

Submissions

Urokinase plasminogen activator surface receptor

Summary

UniProt ID: P35456
Gene Symbol: Plaur
Gene ID: 18793
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003589
GlyGen: P35456
PubChem: P35456
RaftProt: P35456
Re-Glyco: P35456

Annotation

Keyword: 3D-structure Alternative splicing Cell membrane Disulfide bond GPI-anchor Receptor Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of plasminogen activation	NAS	PMID
regulation of cell adhesion	ISO	GO_REF
regulation of cell adhesion	IEA	GO_REF
positive regulation of homotypic cell-cell adhesion	ISO	GO_REF
positive regulation of homotypic cell-cell adhesion	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

urokinase plasminogen activator signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in prostate gland development

mesenchymal cell differentiation

reproductive process [inference]

developmental process involved in reproduction [inference]

epithelial cell differentiation involved in prostate gland development

developmental process [inference]

developmental process involved in reproduction [inference]

epithelial cell differentiation involved in prostate gland development

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in prostate gland development

mesenchymal cell differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

regulation of fibrinolysis

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

regulation of fibrinolysis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

urokinase plasminogen activator signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

regulation of protein processing [inference]

regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

regulation of protein processing [inference]

regulation of plasminogen activation

regulation of protein maturation [inference]

regulation of protein processing [inference]

regulation of plasminogen activation

regulation of cell adhesion

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

regulation of homotypic cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

regulation of mitochondrion organization [inference]

regulation of release of cytochrome c from mitochondria [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

regulation of fibrinolysis

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

regulation of fibrinolysis

regulation of biological quality [inference]

regulation of body fluid levels [inference]

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

regulation of fibrinolysis

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF GO_REF
plasma membrane	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

protein complex involved in cell adhesion [inference]

protein complex involved in cell-matrix adhesion

catalytic complex [inference]

peptidase complex [inference]

serine-type peptidase complex [inference]

serine-type endopeptidase complex

endopeptidase complex [inference]

serine-type endopeptidase complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
signaling receptor binding	ISO	GO_REF
signaling receptor binding	IEA	GO_REF
enzyme binding	ISO	GO_REF
enzyme binding	IEA	GO_REF
protein domain specific binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGLPRRLLLLLLLATTCVPASQGLQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPTGGAPRPGPAQLSLIASLLLTLGLWGVLLWT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	Description	PubMed ID	Source
32	N-linked (GlcNAc...) asparagine		UniProt GlyGen
75	N-linked (GlcNAc...) asparagine	20133942	UniProt GlyGen
183	N-linked (GlcNAc...) asparagine		GlycoProtDB UniProt GlyGen
193	N-linked (GlcNAc...) asparagine	20133942	UniProt GlyGen
221	N-linked (GlcNAc...) asparagine		UniProt GlyGen
254	N-linked (GlcNAc...) asparagine		GlycoProtDB UniProt GlyGen
282	N-linked (GlcNAc...) asparagine	20133942	UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Attachment of GPI anchor to uPAR	Mus musculus
Dissolution of Fibrin Clot	Mus musculus
FXIIa activates plasma kallikrein-kinin system	Mus musculus
Neutrophil degranulation	Mus musculus
Regulation of FXIIa and plasma kallikrein activity	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements