GlyCosmos Portal

Submissions

Peroxiredoxin-1

Summary

UniProt ID: P35700
Gene Symbol: Msp23 Paga Prdx1 Tdpx2
Gene ID: 18477
Organism: Mus musculus (house mouse)

External Links

GlyGen: P35700
PubChem: P35700
RaftProt: P35700
Re-Glyco: P35700

Annotation

Keyword: Acetylation Antioxidant Cytoplasm Direct protein sequencing Disulfide bond Isopeptide bond Peroxidase Phosphoprotein Redox-active center Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
response to reactive oxygen species	IMP	PMID PMID PMID
response to oxidative stress	IDA	PMID
response to oxidative stress	IMP	PMID
response to oxidative stress	IBA	GO_REF
response to oxidative stress	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

lymphocyte mediated immunity [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

myeloid cell homeostasis [inference]

erythrocyte homeostasis

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

leukocyte activation

lymphocyte activation [inference]

natural killer cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation

lymphocyte activation [inference]

natural killer cell activation

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

natural killer cell mediated cytotoxicity

metabolic process [inference]

catabolic process [inference]

hydrogen peroxide catabolic process

reactive oxygen species metabolic process [inference]

superoxide metabolic process [inference]

removal of superoxide radicals

hydrogen peroxide metabolic process [inference]

hydrogen peroxide catabolic process

cell population proliferation

cellular detoxification [inference]

cellular oxidant detoxification [inference]

removal of superoxide radicals

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation

lymphocyte activation [inference]

natural killer cell activation

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

myeloid cell homeostasis [inference]

erythrocyte homeostasis

homeostatic process [inference]

cellular homeostasis [inference]

cell redox homeostasis

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

myeloid cell homeostasis [inference]

erythrocyte homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to oxidative stress

response to reactive oxygen species

immune response [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

natural killer cell mediated immunity [inference]

natural killer cell mediated cytotoxicity

response to chemical [inference]

response to oxygen-containing compound [inference]

response to reactive oxygen species

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

regulation of stress-activated MAPK cascade

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

regulation of cellular response to stress [inference]

regulation of stress-activated protein kinase signaling cascade [inference]

regulation of stress-activated MAPK cascade

detoxification [inference]

cellular detoxification [inference]

cellular oxidant detoxification [inference]

removal of superoxide radicals

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
euchromatin	ISO	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

chromatin [inference]

euchromatin

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

mitochondrial matrix

microbody lumen [inference]

peroxisomal matrix

myelin sheath

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
peroxidase activity	ISO	GO_REF
peroxidase activity	IEA	GO_REF
thioredoxin peroxidase activity	ISO	GO_REF
thioredoxin peroxidase activity	IBA	GO_REF
thioredoxin peroxidase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on peroxide as acceptor [inference]

peroxidase activity

peroxiredoxin activity

thioredoxin-dependent peroxiredoxin activity [inference]

thioredoxin peroxidase activity

binding [inference]

protein binding [inference]

identical protein binding

tetrapyrrole binding [inference]

heme binding

antioxidant activity [inference]

peroxidase activity

peroxiredoxin activity

thioredoxin-dependent peroxiredoxin activity [inference]

thioredoxin peroxidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
189			G02815KT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Detoxification of Reactive Oxygen Species	Mus musculus
NFE2L2 regulating anti-oxidant/detoxification enzymes	Mus musculus
Scavenging by Class B Receptors	Mus musculus
TP53 Regulates Metabolic Genes	Mus musculus