GlyCosmos Portal

Submissions

Folate receptor alpha

Summary

UniProt ID

P35846

Gene Symbol

Fbp1
Folbp1
Folr1

Gene ID

[14275]

Organism

Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003598
PubChem: P35846
Re-Glyco: P35846

Annotation

Keyword: Cell membrane Cytoplasmic vesicle Disulfide bond Endosome Folate-binding GPI-anchor Receptor Reference proteome Secreted Signal Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 21 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
heart looping	IMP	PMID
neural crest cell migration involved in heart formation	IMP	PMID
cardiac neural crest cell migration involved in outflow tract morphogenesis	IMP	PMID
post-translational protein targeting to endoplasmic reticulum membrane	TAS	PMID
cell adhesion

GO Hierarchy

biological process

cellular process [inference]

cell adhesion

cell recognition [inference]

cell-cell recognition [inference]

sperm-egg recognition

metabolic process [inference]

modified amino acid metabolic process [inference]

folic acid-containing compound metabolic process [inference]

folic acid-containing compound biosynthetic process [inference]

tetrahydrofolate biosynthetic process

tetrahydrofolate metabolic process [inference]

tetrahydrofolate biosynthetic process

folic acid metabolic process

modified amino acid biosynthetic process [inference]

folic acid-containing compound biosynthetic process [inference]

tetrahydrofolate biosynthetic process

biosynthetic process [inference]

modified amino acid biosynthetic process [inference]

folic acid-containing compound biosynthetic process [inference]

tetrahydrofolate biosynthetic process

pteridine-containing compound biosynthetic process [inference]

folic acid-containing compound biosynthetic process [inference]

tetrahydrofolate biosynthetic process

pteridine-containing compound metabolic process [inference]

folic acid-containing compound metabolic process [inference]

folic acid-containing compound biosynthetic process [inference]

tetrahydrofolate biosynthetic process

tetrahydrofolate metabolic process [inference]

tetrahydrofolate biosynthetic process

folic acid metabolic process

pteridine-containing compound biosynthetic process [inference]

folic acid-containing compound biosynthetic process [inference]

tetrahydrofolate biosynthetic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

dicarboxylic acid metabolic process [inference]

folic acid metabolic process

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

cell motility [inference]

cell migration [inference]

ameboidal-type cell migration [inference]

mesenchymal cell migration [inference]

neural crest cell migration [inference]

cell migration involved in heart development [inference]

cardiac neural crest cell migration involved in outflow tract morphogenesis

cell migration involved in heart formation [inference]

neural crest cell migration involved in heart formation

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration

cellular response to chemical stimulus [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

cellular response to nitrogen compound [inference]

cellular response to folic acid

cellular response to oxygen-containing compound [inference]

cellular response to folic acid

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection regeneration [inference]

axon regeneration

axon development [inference]

axon regeneration

reproductive process [inference]

multicellular organismal reproductive process [inference]

cellular process involved in reproduction in multicellular organism [inference]

fusion of sperm to egg plasma membrane involved in single fertilization

developmental process [inference]

anatomical structure morphogenesis [inference]

tube morphogenesis [inference]

blood vessel morphogenesis [inference]

artery morphogenesis [inference]

pharyngeal arch artery morphogenesis

epithelial tube morphogenesis [inference]

embryonic heart tube morphogenesis [inference]

heart looping

embryonic morphogenesis [inference]

embryonic heart tube morphogenesis [inference]

heart looping

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

epithelial tube morphogenesis [inference]

embryonic heart tube morphogenesis [inference]

heart looping

anatomical structure formation involved in morphogenesis [inference]

tube formation [inference]

tube closure [inference]

anterior neural tube closure

anatomical structure development [inference]

regeneration [inference]

neuron projection regeneration [inference]

axon regeneration

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

response to axon injury

axon regeneration

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration

response to nutrient levels [inference]

response to nutrient [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

response to vitamin [inference]

response to folic acid [inference]

cellular response to folic acid

cellular response to vitamin [inference]

cellular response to folic acid

cellular response to nutrient levels [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

response to chemical [inference]

response to nutrient [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

response to vitamin [inference]

response to folic acid [inference]

cellular response to folic acid

cellular response to vitamin [inference]

cellular response to folic acid

cellular response to chemical stimulus [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

cellular response to nitrogen compound [inference]

cellular response to folic acid

cellular response to oxygen-containing compound [inference]

cellular response to folic acid

response to nitrogen compound [inference]

response to folic acid [inference]

cellular response to folic acid

cellular response to nitrogen compound [inference]

cellular response to folic acid

response to oxygen-containing compound [inference]

response to folic acid [inference]

cellular response to folic acid

cellular response to oxygen-containing compound [inference]

cellular response to folic acid

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

cellular response to stress [inference]

neuron projection regeneration [inference]

axon regeneration

cellular response to chemical stimulus [inference]

cellular response to nutrient [inference]

cellular response to vitamin [inference]

cellular response to folic acid

cellular response to nitrogen compound [inference]

cellular response to folic acid

cellular response to oxygen-containing compound [inference]

cellular response to folic acid

localization [inference]

establishment of localization [inference]

transport [inference]

organic anion transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

folic acid transport

organic acid transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

folic acid transport

vitamin transport [inference]

folic acid transport

nitrogen compound transport [inference]

modified amino acid transport [inference]

folic acid transport

establishment of protein localization [inference]

protein targeting [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

protein targeting to ER [inference]

post-translational protein targeting to endoplasmic reticulum membrane

establishment of protein localization to organelle [inference]

establishment of protein localization to endoplasmic reticulum [inference]

protein targeting to ER [inference]

post-translational protein targeting to endoplasmic reticulum membrane

establishment of protein localization to membrane [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

cellular localization [inference]

localization within membrane [inference]

establishment of protein localization to membrane [inference]

protein targeting to membrane [inference]

post-translational protein targeting to endoplasmic reticulum membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of Wnt signaling pathway [inference]

regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of Wnt signaling pathway [inference]

regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of cellular response to transforming growth factor beta stimulus [inference]

regulation of transforming growth factor beta receptor signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of Wnt signaling pathway [inference]

regulation of canonical Wnt signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of transforming growth factor beta receptor signaling pathway

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF
endosome	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane

plasma membrane

plasma membrane region [inference]

cell projection membrane [inference]

brush border membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

coated vesicle [inference]

clathrin-coated vesicle

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

coated vesicle [inference]

clathrin-coated vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

coated vesicle [inference]

clathrin-coated vesicle

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
folic acid binding	ISS	GO_REF
folic acid binding	ISO	GO_REF
folic acid binding	TAS	PMID
folic acid binding	IEA	GO_REF
signaling receptor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

vitamin binding [inference]

folic acid binding

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

folic acid binding

organic acid binding [inference]

carboxylic acid binding [inference]

folic acid binding

heterocyclic compound binding [inference]

folic acid binding

modified amino acid binding [inference]

folic acid binding

cargo receptor activity [inference]

folic acid receptor activity

molecular transducer activity [inference]

signaling receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAHLMTVQLLLLVMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGFHGTWPLLCSLSLVLLWVIS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	GlyTouCan ID	Source
61		G46312WW G54678CA G15450FJ G79421NO G44231RW G35510GA G44437FL G04062KZ G02281EI G27336AY	GlycoProtDB
67	N-linked (GlcNAc...) asparagine	G46312WW G54678CA G15450FJ G79421NO G44231RW G35510GA G44437FL G04062KZ G02281EI G27336AY	GlycoProtDB UniProt
159	N-linked (GlcNAc...) asparagine		UniProt
199	N-linked (GlcNAc...) asparagine		UniProt