GlyCosmos Portal

Submissions

Lysosomal acid lipase/cholesteryl ester hydrolase

Summary

UniProt ID: P38571
Gene Symbol: LIPA
Gene ID: 3988
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011671

GlyConnect

Lysosomal acid lipase/cholesteryl ester hydrolase

GlyGen

P38571

PubChem

P38571

SwissLipids

SLP:000001261

The Human Metabolome Database

HMDBP00227

The O-GlcNAc Database

P38571

Re-Glyco

P38571

Annotation

Keyword: 3D-structure Alternative splicing Direct protein sequencing Disease variant Glycoprotein Hydrolase Lipid degradation Lysosome Proteomics identification Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 58 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
mitotic cell cycle
cell morphogenesis
endothelial cell proliferation
response to dietary excess
hematopoietic progenitor cell differentiation

GO Hierarchy

biological process

immune system process [inference]

leukocyte homeostasis [inference]

macrophage homeostasis

immune effector process [inference]

respiratory burst involved in defense response [inference]

respiratory burst involved in inflammatory response

myeloid cell homeostasis [inference]

macrophage homeostasis

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation

T cell activation [inference]

lymphocyte proliferation [inference]

T cell proliferation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation

T cell activation [inference]

lymphocyte proliferation [inference]

T cell proliferation

cell cycle [inference]

mitotic cell cycle

signal transduction [inference]

intracellular signal transduction [inference]

TOR signaling

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction

metabolic process [inference]

generation of precursor metabolites and energy [inference]

glycolytic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ATP metabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ATP metabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process

lipid catabolic process

carbohydrate catabolic process [inference]

glycolytic process

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine-containing compound catabolic process [inference]

pyridine nucleotide catabolic process [inference]

glycolytic process

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

biosynthetic process [inference]

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

macromolecule biosynthetic process [inference]

gene expression

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

small molecule biosynthetic process [inference]

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

organophosphate biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

reactive oxygen species biosynthetic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process

macromolecule biosynthetic process [inference]

gene expression

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process

lipoprotein metabolic process [inference]

lipoprotein catabolic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process

carbohydrate catabolic process [inference]

glycolytic process

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound biosynthetic process [inference]

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ATP metabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

lipid metabolic process [inference]

fatty acid metabolic process

neutral lipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

isoprenoid metabolic process [inference]

terpenoid metabolic process [inference]

diterpenoid metabolic process [inference]

retinoid metabolic process [inference]

vitamin A metabolic process

steroid metabolic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

sterol metabolic process

cholesterol metabolic process [inference]

cholesterol biosynthetic process

sterol biosynthetic process [inference]

cholesterol biosynthetic process

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

lipid catabolic process

glycerolipid metabolic process [inference]

acylglycerol metabolic process [inference]

triglyceride metabolic process

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process

lipoprotein metabolic process [inference]

lipoprotein catabolic process

small molecule metabolic process [inference]

monosaccharide metabolic process [inference]

hexose metabolic process [inference]

glucose metabolic process

alcohol metabolic process [inference]

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

secondary alcohol metabolic process [inference]

cholesterol metabolic process [inference]

cholesterol biosynthetic process

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

pyruvate metabolic process [inference]

glycolytic process

fatty acid metabolic process

small molecule biosynthetic process [inference]

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nicotinamide nucleotide metabolic process [inference]

glycolytic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleoside triphosphate metabolic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine nucleoside triphosphate metabolic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleoside triphosphate metabolic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ATP metabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine nucleotide catabolic process [inference]

glycolytic process

nucleoside phosphate biosynthetic process [inference]

nucleoside triphosphate biosynthetic process [inference]

purine nucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

ribonucleoside triphosphate biosynthetic process [inference]

purine ribonucleoside triphosphate biosynthetic process [inference]

ATP biosynthetic process

nucleotide biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

respiratory burst [inference]

respiratory burst involved in defense response [inference]

respiratory burst involved in inflammatory response

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

purine-containing compound biosynthetic process [inference]

purine nucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

pyridine-containing compound metabolic process [inference]

nicotinamide nucleotide metabolic process [inference]

glycolytic process

pyridine-containing compound catabolic process [inference]

pyridine nucleotide catabolic process [inference]

glycolytic process

reactive oxygen species metabolic process [inference]

reactive oxygen species biosynthetic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ADP metabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ATP metabolic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process [inference]

glycolytic process

carbohydrate derivative biosynthetic process [inference]

ribose phosphate biosynthetic process [inference]

ribonucleotide biosynthetic process [inference]

purine ribonucleotide biosynthetic process [inference]

ATP biosynthetic process

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

myeloid cell apoptotic process

leukocyte apoptotic process [inference]

lymphocyte apoptotic process [inference]

T cell apoptotic process

cell population proliferation [inference]

common myeloid progenitor cell proliferation

epithelial cell proliferation [inference]

endothelial cell proliferation

fat cell proliferation

leukocyte proliferation [inference]

mononuclear cell proliferation [inference]

lymphocyte proliferation [inference]

T cell proliferation

cell proliferation in bone marrow

intercellular transport [inference]

endosome to lysosome transport

vesicle-mediated transport [inference]

cellular developmental process [inference]

cell differentiation [inference]

hematopoietic progenitor cell differentiation

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation

myeloid cell differentiation

epithelial cell differentiation [inference]

endothelial cell differentiation [inference]

blood vessel endothelial cell differentiation

cellular localization [inference]

intracellular transport [inference]

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

vacuole organization [inference]

lytic vacuole organization [inference]

lysosome organization

nutrient storage [inference]

lipid storage [inference]

cholesterol storage

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation

T cell activation [inference]

lymphocyte proliferation [inference]

T cell proliferation

production of molecular mediator involved in inflammatory response [inference]

respiratory burst involved in inflammatory response

system process [inference]

excretion [inference]

defecation

digestive system process [inference]

defecation

determination of adult lifespan

plasma lipoprotein particle clearance [inference]

tissue remodeling

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

adaptive thermogenesis

homeostasis of number of cells [inference]

leukocyte homeostasis [inference]

macrophage homeostasis

myeloid cell homeostasis [inference]

macrophage homeostasis

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

energy homeostasis [inference]

response to dietary excess

multicellular organismal-level chemical homeostasis

developmental process [inference]

anatomical structure morphogenesis [inference]

cell morphogenesis

animal organ morphogenesis [inference]

gland morphogenesis [inference]

liver morphogenesis

anatomical structure development [inference]

tissue development [inference]

bone marrow development

connective tissue development [inference]

adipose tissue development

animal organ development [inference]

lung development

hematopoietic or lymphoid organ development [inference]

cellular developmental process [inference]

cell differentiation [inference]

hematopoietic progenitor cell differentiation

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation

myeloid cell differentiation

epithelial cell differentiation [inference]

endothelial cell differentiation [inference]

blood vessel endothelial cell differentiation

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

temperature homeostasis [inference]

adaptive thermogenesis

homeostasis of number of cells [inference]

leukocyte homeostasis [inference]

macrophage homeostasis

myeloid cell homeostasis [inference]

macrophage homeostasis

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

energy homeostasis [inference]

response to dietary excess

multicellular organismal-level chemical homeostasis

chemical homeostasis [inference]

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response [inference]

acute inflammatory response

response to cold

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

response to cold

response to nutrient levels [inference]

response to dietary excess

response to nutrient [inference]

response to vitamin [inference]

response to vitamin A

response to chemical [inference]

response to nutrient [inference]

response to vitamin [inference]

response to vitamin A

response to xenobiotic stimulus

response to lipid [inference]

response to vitamin A

response to nitrogen compound [inference]

response to rapamycin

response to oxygen-containing compound [inference]

response to ether [inference]

response to rapamycin

response to alcohol [inference]

response to rapamycin

response to ketone [inference]

response to rapamycin

localization [inference]

establishment of localization [inference]

transport [inference]

lipid transport [inference]

sterol transport [inference]

cholesterol transport [inference]

cholesterol efflux

lipid import into cell

intercellular transport [inference]

endosome to lysosome transport

organic hydroxy compound transport [inference]

sterol transport [inference]

cholesterol transport [inference]

cholesterol efflux

vesicle-mediated transport [inference]

intracellular transport [inference]

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

import into cell [inference]

endocytosis

establishment of localization in cell [inference]

intracellular transport [inference]

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

cellular localization [inference]

intracellular transport [inference]

vacuolar transport [inference]

lysosomal transport [inference]

endosome to lysosome transport

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of immune response [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of immune response [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of immune response [inference]

positive regulation of immune response [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

TOR signaling

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of antigen receptor-mediated signaling pathway [inference]

regulation of T cell receptor signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of antigen receptor-mediated signaling pathway [inference]

positive regulation of T cell receptor signaling pathway

regulation of biological quality [inference]

regulation of membrane potential [inference]

regulation of mitochondrial membrane potential

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
fibrillar center
nucleoplasm
lysosome	ISS	GO_REF
lysosome	TAS	PMID
lysosome	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

vacuolar lumen [inference]

lysosomal lumen

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
sterol ester esterase activity	TAS	Reactome
sterol ester esterase activity	IDA	PMID PMID PMID PMID
sterol ester esterase activity	IMP	PMID
sterol ester esterase activity	IBA	GO_REF
sterol ester esterase activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity

sterol ester esterase activity

carboxylic ester hydrolase activity [inference]

sterol ester esterase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKMRFLGLVVCLVLWTLHSEGSGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 9** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
36	N-linked (GlcNAc...) asparagine		G20991XV	UniProt GlyGen
72	N-linked (GlcNAc...) asparagine			UniProt GlyGen
101	N-linked (GlcNAc...) asparagine			UniProt GlyGen
119		24190977		GlyGen
155		37340703	G49108TO	The O-GlcNAc Database
161	N-linked (GlcNAc...) asparagine	19159218 24190977 29741879 37074911	G66088HZ G70232NH G03644CB G47518TP G93718GY G57776ZS G68490OW G90382BL G79666IR G45395BF G43223CG G48414YA G27058EU G83460ZZ G08290VR G46503DX G70101JE G80920RR G29299MO G62765YT G62894KT G11870QZ G47644PP G31852PQ G11314AS G39188ZX G41247ZX G02815KT G06110VR G74724QE G92275SC	GlycoProtDB UniProt GlyGen GlyConnect
271		8941718		GlyGen
273	N-linked (GlcNAc...) asparagine	29741879 37074911	G83460ZZ G70101JE G80920RR G62765YT G64527OM G05724UK G31852PQ G41247ZX G02815KT G92050GC G28681TP	UniProt GlyGen GlyConnect
321	N-linked (GlcNAc...) asparagine	19159218 24190977 29741879 37074911	G92135MA G45395BF G78787DI G43769HG G96091TT G08290VR G92406TI G80920RR G59924QI G62765YT G47950XN G47644PP G31852PQ G90575OW G41247ZX G50282JC G02815KT G74724QE G92275SC	GlycoProtDB UniProt GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
LDL clearance	Homo sapiens

Human Protein Atlas

ENSG00000107798

Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.

Data available from v23.0.proteinatlas.org. Image credit: Human Protein Atlas

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:14497	Wolman disease	Glyco-Disease Genes Database Alliance of Genome Resources
DOID:14502	cholesterol ester storage disease	Alliance of Genome Resources
DOID:0080217	lysosomal acid lipase deficiency	Glyco-Disease Genes Database

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements