GlyCosmos Portal

Submissions

Thrombopoietin

Summary

UniProt ID: P40225
Gene Symbol: THPO MGDF
Gene ID: 7066
Organism: Homo sapiens (human)

External Links

GlyConnect

Thrombopoietin

GlyGen

P40225

PubChem

P40225

Re-Glyco

P40225

Annotation

Keyword: 3D-structure Alternative splicing Cytokine Disease variant Disulfide bond Glycoprotein Hormone Proteomics identification Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of protein phosphorylation	ISS	GO_REF
cell population proliferation	IEA	GO_REF
positive regulation of cell population proliferation	IDA	PMID
megakaryocyte differentiation	IDA	PMID
megakaryocyte differentiation	IMP	PMID PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

chemokine-mediated signaling pathway [inference]

thrombopoietin-mediated signaling pathway

cell surface receptor signaling pathway via STAT

G protein-coupled receptor signaling pathway [inference]

chemokine-mediated signaling pathway [inference]

thrombopoietin-mediated signaling pathway

cell population proliferation

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

megakaryocyte differentiation

cell development [inference]

hemopoiesis [inference]

myeloid cell development [inference]

megakaryocyte development

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

hemopoiesis [inference]

myeloid cell development [inference]

megakaryocyte development

cellular developmental process [inference]

cell differentiation [inference]

myeloid cell differentiation [inference]

megakaryocyte differentiation

cell development [inference]

hemopoiesis [inference]

myeloid cell development [inference]

megakaryocyte development

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

chemokine-mediated signaling pathway [inference]

thrombopoietin-mediated signaling pathway

cell surface receptor signaling pathway via STAT

G protein-coupled receptor signaling pathway [inference]

chemokine-mediated signaling pathway [inference]

thrombopoietin-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

regulation of phosphorylation [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

regulation of protein phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

regulation of stem cell proliferation [inference]

regulation of hematopoietic stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of cell development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of stem cell proliferation [inference]

positive regulation of hematopoietic stem cell proliferation

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of protein phosphorylation

positive regulation of phosphate metabolic process [inference]

positive regulation of phosphorylation [inference]

positive regulation of protein phosphorylation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of ERK1 and ERK2 cascade

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of multicellular organismal process [inference]

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

positive regulation of myeloid cell differentiation [inference]

positive regulation of megakaryocyte differentiation

regulation of megakaryocyte differentiation [inference]

positive regulation of megakaryocyte differentiation

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	EXP	PMID PMID
extracellular region	IBA	GO_REF
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying **all 5** entries
GO Term	Evidence Code	Reference
signaling receptor binding	IBA	GO_REF
cytokine activity	IDA	PMID
cytokine activity	IEA	GO_REF
hormone activity	IEA	GO_REF
growth factor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 17 in total

1

2

Next ›

Last »
Position	Description	PubMed ID	GlyTouCan ID	Source
22	O-linked (GalNAc...) serine	8942648		UniProt GlyGen
58	O-linked (GalNAc...) threonine	8942648		UniProt GlyGen
131	O-linked (GalNAc...) threonine	8942648		UniProt GlyGen
179	O-linked (GalNAc...) threonine	8942648		UniProt GlyGen
180	O-linked (GalNAc...) threonine	8942648		UniProt GlyGen
184	O-linked (GalNAc...) serine	8942648		UniProt GlyGen
197	N-linked (GlcNAc...) (complex) asparagine	8942648	G56501FP G94531EZ G47058MH G14389GM G57789QC G00227RN G01817YC G00800WJ G90352XZ G17689DH G16265MV G44444MB	UniProt GlyGen
206	N-linked (GlcNAc...) (complex) asparagine	8942648		UniProt GlyGen
213	O-linked (GalNAc...) threonine	8942648		UniProt GlyGen
234	N-linked (GlcNAc...) (complex) asparagine	8942648		UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Platelet Aggregation (Plug Formation)	Homo sapiens

Disease

Displaying **all 5** entries
DO ID	Disease Name	Source
DOID:1588	thrombocytopenia	Alliance of Genome Resources
DOID:2228	thrombocytosis	Alliance of Genome Resources
DOID:0061002	congenital amegakaryocytic thrombocytopenia 2	Alliance of Genome Resources
DOID:12449	aplastic anemia	Alliance of Genome Resources
DOID:2224	essential thrombocythemia	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements