GlyCosmos Portal

Submissions

Tumor necrosis factor ligand superfamily member 6

Summary

UniProt ID: P41047
Gene Symbol: Faslg Apt1lg1 Cd95l Fasl Tnfsf6 gld
Gene ID: 14103
Organism: Mus musculus (house mouse)

External Links

PubChem: P41047
Re-Glyco: P41047

Annotation

Keyword: Alternative splicing Apoptosis Cell membrane Cytokine Cytoplasmic vesicle Disease variant Disulfide bond Glycoprotein Lysosome Nucleus Reference proteome Repressor Secreted Signal-anchor Transcription regulation Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 45 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	ISS	GO_REF
negative regulation of transcription by RNA polymerase II	ISO	GO_REF
negative regulation of transcription by RNA polymerase II	IEA	GO_REF
inflammatory cell apoptotic process	ISO	GO_REF
inflammatory cell apoptotic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

apoptotic signaling pathway

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

necroptotic signaling pathway

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

inflammatory cell apoptotic process

leukocyte apoptotic process [inference]

lymphocyte apoptotic process [inference]

T cell apoptotic process

programmed cell death involved in cell development [inference]

retinal cell programmed cell death

programmed necrotic cell death [inference]

necroptotic process

intercellular transport [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

retinal cell programmed cell death

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

cellular component organization or biogenesis [inference]

cellular component organization [inference]

membrane organization [inference]

regulation of membrane lipid distribution [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

developmental process [inference]

cellular developmental process [inference]

programmed cell death involved in cell development [inference]

retinal cell programmed cell death

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic anion homeostasis [inference]

intracellular chloride ion homeostasis

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

endosomal lumen acidification

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic anion homeostasis [inference]

intracellular chloride ion homeostasis

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

endosomal lumen acidification

monoatomic cation homeostasis [inference]

regulation of pH [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

endosomal lumen acidification

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

endosomal lumen acidification

monoatomic anion homeostasis [inference]

intracellular monoatomic anion homeostasis [inference]

intracellular chloride ion homeostasis

chloride ion homeostasis [inference]

intracellular chloride ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic anion homeostasis [inference]

intracellular chloride ion homeostasis

intracellular monoatomic cation homeostasis [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

endosomal lumen acidification

inorganic ion homeostasis [inference]

chloride ion homeostasis [inference]

intracellular chloride ion homeostasis

response to stimulus [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin [inference]

response to lipopolysaccharide

response to endogenous stimulus [inference]

response to growth factor

response to chemical [inference]

response to lipid [inference]

response to lipopolysaccharide

response to peptide [inference]

response to cytokine [inference]

response to type II interferon [inference]

cellular response to type II interferon

cellular response to cytokine stimulus [inference]

cellular response to type II interferon

response to oxygen-containing compound [inference]

response to lipopolysaccharide

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

calcium ion transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

intercellular transport [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

release of sequestered calcium ion into cytosol [inference]

release of sequestered calcium ion into cytosol by endoplasmic reticulum

biological regulation [inference]

regulation of pH [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

endosomal lumen acidification

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phospholipid transport [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of lipid localization [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phospholipid transport [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of phospholipid transport [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

apoptotic signaling pathway

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway via death domain receptors

necroptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of endothelial cell apoptotic process [inference]

positive regulation of endothelial cell apoptotic process

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular component organization [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of cellular component organization [inference]

positive regulation of cellular component organization [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of plasma membrane organization [inference]

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of biological quality [inference]

regulation of intracellular pH [inference]

intracellular pH reduction [inference]

endosomal lumen acidification

regulation of membrane lipid distribution [inference]

regulation of phospholipid translocation [inference]

positive regulation of phospholipid translocation [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

regulation of phosphatidylserine exposure on apoptotic cell surface [inference]

positive regulation of phosphatidylserine exposure on apoptotic cell surface

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IEA	GO_REF GO_REF
cytoplasm	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

plasma membrane raft [inference]

caveola

membrane microdomain [inference]

membrane raft [inference]

plasma membrane raft [inference]

caveola

membrane-enclosed lumen [inference]

organelle lumen [inference]

vesicle lumen [inference]

cytoplasmic vesicle lumen

intracellular organelle lumen [inference]

vacuolar lumen [inference]

lysosomal lumen

cytoplasmic vesicle lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

nucleus

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

perinuclear region of cytoplasm

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
death receptor binding	ISO	GO_REF
death receptor binding	IEA	GO_REF
cytokine activity	ISO	GO_REF
cytokine activity	IBA	GO_REF
cytokine activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

tumor necrosis factor receptor superfamily binding [inference]

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQPLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSLKVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
117	N-linked (GlcNAc...) asparagine	UniProt
182	N-linked (GlcNAc...) asparagine	UniProt
248	N-linked (GlcNAc...) asparagine	UniProt
258	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
CASP8 activity is inhibited	Mus musculus
Dimerization of procaspase-8	Mus musculus
FasL/ CD95L signaling	Mus musculus
Regulation by c-FLIP	Mus musculus

Disease

Displaying **all 2** entries
DO ID	Disease Name	Source
DOID:6688	autoimmune lymphoproliferative syndrome	Alliance of Genome Resources
DOID:9744	type 1 diabetes mellitus	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements