GlyCosmos Portal

Submissions

Lymphotoxin-beta

Summary

UniProt ID

P41155

Gene Symbol

Ltb
Tnfc
Tnfsf3

Gene ID

[16994]

Organism

Mus musculus (house mouse)

External Links

PubChem: P41155
Re-Glyco: P41155

Annotation

Keyword: Cytokine Glycoprotein Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
immune response	IEA	GO_REF
cell surface receptor signaling pathway	IBA	GO_REF
gene expression	IMP	PMID
positive regulation of interleukin-12 production	IMP	PMID
positive regulation of canonical NF-kappaB signal transduction	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

skin development

hematopoietic or lymphoid organ development [inference]

lymph node development

response to stimulus [inference]

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of intracellular signal transduction [inference]

regulation of canonical NF-kappaB signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

regulation of interleukin-12 production [inference]

positive regulation of interleukin-12 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

regulation of interleukin-12 production [inference]

positive regulation of interleukin-12 production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of extrinsic apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of canonical NF-kappaB signal transduction

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway [inference]

positive regulation of extrinsic apoptotic signaling pathway

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

regulation of interleukin-12 production [inference]

positive regulation of interleukin-12 production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of interleukin-12 production

Displaying **all 4** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
plasma membrane	ISO	GO_REF
plasma membrane	TAS	PMID PMID Reactome
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
tumor necrosis factor receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

tumor necrosis factor receptor superfamily binding [inference]

tumor necrosis factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIGSGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASAWMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFFGAVMVG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
98	N-linked (GlcNAc...) asparagine			UniProt
284	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway	Mus musculus
TNFR2 non-canonical NF-kB pathway	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements