GlyCosmos Portal

Submissions

Matrix metalloproteinase-9

Summary

UniProt ID: P41245
Gene Symbol: Clg4b Mmp9
Gene ID: 17395
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003616
PubChem: P41245
Re-Glyco: P41245

Annotation

Keyword: Calcium Collagen degradation Disulfide bond Extracellular matrix Glycoprotein Metal-binding Metalloprotease Reference proteome Repeat Signal Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 50 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	IMP	PMID
skeletal system development	IGI	PMID
positive regulation of leukocyte migration	ISO	GO_REF
proteolysis	ISS	GO_REF
proteolysis	ISO	GO_REF GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

mononuclear cell migration [inference]

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

macrophage migration [inference]

macrophage chemotaxis

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

collagen catabolic process

collagen metabolic process [inference]

collagen catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

primary metabolic process [inference]

protein metabolic process [inference]

cellular developmental process [inference]

cell differentiation [inference]

endodermal cell differentiation

cell motility [inference]

cell migration

leukocyte migration [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

mononuclear cell migration [inference]

macrophage migration [inference]

macrophage chemotaxis

myeloid leukocyte migration [inference]

macrophage migration [inference]

macrophage chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

cellular response to stimulus [inference]

cellular response to cell-matrix adhesion

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell junction organization [inference]

synapse organization [inference]

modification of synaptic structure [inference]

modification of synaptic structure, modulating synaptic transmission

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

reproductive process [inference]

embryo implantation

multicellular organismal process [inference]

tissue remodeling

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

heart development

system development [inference]

skeletal system development

cellular developmental process [inference]

cell differentiation [inference]

endodermal cell differentiation

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis [inference]

leukocyte chemotaxis [inference]

macrophage chemotaxis

response to stimulus [inference]

response to stress [inference]

response to oxidative stress

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

response to UV [inference]

cellular response to UV [inference]

cellular response to UV-A

response to UV-A [inference]

cellular response to UV-A

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

response to chemical [inference]

response to xenobiotic stimulus

response to nitrogen compound [inference]

response to amyloid-beta

response to oxygen-containing compound [inference]

response to amyloid-beta

cellular response to stimulus [inference]

cellular response to cell-matrix adhesion

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus [inference]

cellular response to UV [inference]

cellular response to UV-A

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

positive regulation of synaptic plasticity

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of monoatomic ion transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of monoatomic cation transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of monoatomic ion transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of monoatomic cation transmembrane transport [inference]

negative regulation of cation transmembrane transport

negative regulation of monoatomic ion transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

negative regulation of transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

negative regulation of monoatomic ion transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of cellular localization [inference]

regulation of postsynaptic neurotransmitter receptor diffusion trapping

regulation of receptor localization to synapse [inference]

regulation of postsynaptic neurotransmitter receptor diffusion trapping

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of fibroblast proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

negative regulation of monoatomic ion transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of epithelial cell differentiation involved in kidney development [inference]

negative regulation of epithelial cell differentiation involved in kidney development

negative regulation of cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

positive regulation of developmental process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of epithelial cell differentiation involved in kidney development [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

positive regulation of synaptic plasticity

regulation of transmembrane transport [inference]

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of monoatomic ion transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of monoatomic cation transmembrane transport [inference]

negative regulation of cation transmembrane transport

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of fibroblast proliferation

regulation of fibroblast proliferation [inference]

negative regulation of fibroblast proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of epithelial cell differentiation involved in kidney development [inference]

negative regulation of epithelial cell differentiation involved in kidney development

negative regulation of cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of fibroblast proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of transmembrane transport [inference]

negative regulation of monoatomic ion transmembrane transport [inference]

negative regulation of cation transmembrane transport

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

regulation of mitochondrion organization [inference]

regulation of release of cytochrome c from mitochondria [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

regulation of cellular localization [inference]

regulation of postsynaptic neurotransmitter receptor diffusion trapping

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of multicellular organismal process [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration [inference]

positive regulation of keratinocyte migration

regulation of keratinocyte migration [inference]

positive regulation of keratinocyte migration

positive regulation of multicellular organismal process [inference]

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of epithelial cell differentiation involved in kidney development [inference]

negative regulation of epithelial cell differentiation involved in kidney development

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

positive regulation of angiogenesis

positive regulation of vasculature development [inference]

positive regulation of angiogenesis

regulation of biological quality [inference]

regulation of synaptic plasticity [inference]

positive regulation of synaptic plasticity

regulation of postsynaptic neurotransmitter receptor diffusion trapping

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
extracellular matrix	ISO	GO_REF GO_REF
extracellular matrix	IEA	GO_REF GO_REF
extracellular matrix	HDA	PMID
protein-containing complex	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

cellular anatomical structure [inference]

cell junction [inference]

synapse [inference]

external encapsulating structure [inference]

extracellular matrix

specialized extracellular matrix [inference]

extracellular matrix of synaptic cleft

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

postsynaptic specialization, intracellular component [inference]

postsynaptic density, intracellular component

intracellular organelle [inference]

intracellular membraneless organelle [inference]

postsynaptic specialization, intracellular component [inference]

postsynaptic density, intracellular component

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
fibronectin binding	ISO	GO_REF
endopeptidase activity	ISO	GO_REF
endopeptidase activity	IEA	GO_REF
metalloendopeptidase activity	ISS	GO_REF
metalloendopeptidase activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity

endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

metallopeptidase activity

metalloendopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity

endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

metallopeptidase activity

metalloendopeptidase activity

binding [inference]

protein binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

protein-containing complex binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQMMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHNITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRSYSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYSACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSSCTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPTVGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFDAIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFFSGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKVDPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVGYVTYDLLQCP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
39	N-linked (GlcNAc...) asparagine	UniProt
120	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
127	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 8** entries
Pathway Name	Organism
Activation of Matrix Metalloproteinases	Mus musculus
Assembly of collagen fibrils and other multimeric structures	Mus musculus
Collagen degradation	Mus musculus
Degradation of the extracellular matrix	Mus musculus
EPH-ephrin mediated repulsion of cells	Mus musculus
Extra-nuclear estrogen signaling	Mus musculus
Neutrophil degranulation	Mus musculus
Signaling by SCF-KIT	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements