GlyCosmos Portal

Submissions

CD27 antigen

Summary

UniProt ID: P41272
Gene Symbol: Cd27 Tnfrsf7
Gene ID: 21940
Organism: Mus musculus (house mouse)

External Links

PubChem: P41272
Re-Glyco: P41272

Annotation

Keyword: Apoptosis Cell membrane Disulfide bond Glycoprotein Receptor Reference proteome Repeat Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of immunoglobulin production	NAS	PMID
positive regulation of type II interferon production	NAS	PMID
B cell proliferation	NAS	PMID
T cell activation	ISO	GO_REF
T cell activation	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

adaptive immune memory response involving T cells and B cells

adaptive immune memory response [inference]

adaptive immune memory response involving T cells and B cells

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation

B cell activation [inference]

B cell proliferation

lymphocyte proliferation [inference]

B cell proliferation

immunological memory process [inference]

adaptive immune memory response [inference]

adaptive immune memory response involving T cells and B cells

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation

B cell activation [inference]

B cell proliferation

lymphocyte proliferation [inference]

B cell proliferation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

cell population proliferation [inference]

leukocyte proliferation [inference]

mononuclear cell proliferation [inference]

lymphocyte proliferation [inference]

B cell proliferation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

T cell activation

B cell activation [inference]

B cell proliferation

lymphocyte proliferation [inference]

B cell proliferation

response to stimulus [inference]

immune response [inference]

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

adaptive immune memory response involving T cells and B cells

adaptive immune memory response [inference]

adaptive immune memory response involving T cells and B cells

response to chemical [inference]

response to oxygen-containing compound [inference]

response to alcohol [inference]

response to ethanol

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of B cell activation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of JNK cascade [inference]

positive regulation of JNK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process

regulation of leukocyte apoptotic process [inference]

regulation of lymphocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process

regulation of T cell apoptotic process [inference]

negative regulation of T cell apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of JNK cascade

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

negative regulation of cellular process [inference]

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of B cell activation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

regulation of lymphocyte activation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

regulation of T cell activation [inference]

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

regulation of B cell activation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell differentiation

positive regulation of B cell activation [inference]

positive regulation of B cell differentiation

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of leukocyte differentiation [inference]

regulation of lymphocyte differentiation [inference]

regulation of B cell differentiation [inference]

positive regulation of B cell differentiation

regulation of T cell differentiation [inference]

positive regulation of T cell differentiation

positive regulation of lymphocyte differentiation [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

positive regulation of hemopoiesis [inference]

positive regulation of leukocyte differentiation [inference]

positive regulation of lymphocyte differentiation [inference]

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IDA	PMID
plasma membrane	IEA	GO_REF GO_REF GO_REF
external side of plasma membrane	IDA	PMID PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
transmembrane signaling receptor activity	ISO	GO_REF
transmembrane signaling receptor activity	IDA	PMID
transmembrane signaling receptor activity	IEA	GO_REF GO_REF GO_REF
cysteine-type endopeptidase inhibitor activity involved in apoptotic process	ISS	GO_REF
cysteine-type endopeptidase inhibitor activity involved in apoptotic process	ISO	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

cysteine-type endopeptidase regulator activity involved in apoptotic process [inference]

cysteine-type endopeptidase inhibitor activity involved in apoptotic process

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAWPPPYWLCMLGTLVGLSATLAPNSCPDKHYWTGGGLCCRMCEPGTFFVKDCEQDRTAAQCDPCIPGTSFSPDYHTRPHCESCRHCNSGFLIRNCTVTANAECSCSKNWQCRDQECTECDPPLNPALTRQPSETPSPQPPPTHLPHGTEKPSWPLHRQLPNSTVYSQRSSHRPLCSSDCIRIFVTFSSMFLIFVLGAILFFHQRRNHGPNEDRQAVPEEPCPYSCPREEEGSAIPIQEDYRKPEPAFYP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
95	N-linked (GlcNAc...) asparagine			UniProt
162	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
TNFs bind their physiological receptors	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements