GlyCosmos Portal

Submissions

ETS domain-containing protein Elk-1

Summary

UniProt ID: P41969
Gene Symbol: Elk1
Gene ID: 13712
Organism: Mus musculus (house mouse)

External Links

GlyGen: P41969
PubChem: P41969
The O-GlcNAc Database: P41969
Re-Glyco: P41969

Annotation

Keyword: Activator DNA-binding Glycoprotein Isopeptide bond Nucleus Phosphoprotein Reference proteome Transcription regulation Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 32 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
liver development	IMP	PMID
regulation of transcription, DNA-templated	IDA	PMID
regulation of DNA-templated transcription	IDA	PMID
regulation of DNA-templated transcription	IEA	GO_REF
regulation of transcription, DNA-templated	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

cell death [inference]

programmed cell death [inference]

apoptotic process [inference]

neuron apoptotic process [inference]

hippocampal neuron apoptotic process

cellular developmental process [inference]

cell differentiation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to lipid

cellular response to testosterone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to testosterone stimulus

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

lung development

gland development [inference]

liver development

cellular developmental process [inference]

cell differentiation

response to stimulus [inference]

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus

response to ionizing radiation [inference]

response to gamma radiation [inference]

cellular response to gamma radiation

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

response to endogenous stimulus [inference]

response to growth factor [inference]

response to fibroblast growth factor

response to chemical [inference]

response to lipid [inference]

response to testosterone [inference]

cellular response to testosterone stimulus

cellular response to lipid

cellular response to testosterone stimulus

cellular response to chemical stimulus [inference]

cellular response to lipid

cellular response to testosterone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to testosterone stimulus

response to oxygen-containing compound [inference]

response to alcohol [inference]

response to ethanol

response to ketone [inference]

response to testosterone [inference]

cellular response to testosterone stimulus

cellular response to ketone [inference]

cellular response to testosterone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to testosterone stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to lipid

cellular response to testosterone stimulus

cellular response to oxygen-containing compound [inference]

cellular response to ketone [inference]

cellular response to testosterone stimulus

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to ionizing radiation [inference]

cellular response to gamma radiation

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of transcription, DNA-templated

regulation of transcription by RNA polymerase II

positive regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of transcription by RNA polymerase II

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF GO_REF
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF GO_REF
nucleoplasm	ISO	GO_REF
nucleoplasm	TAS	Reactome

GO Hierarchy

cellular component

cellular anatomical structure [inference]

nucleoplasm

membrane [inference]

organelle membrane [inference]

mitochondrial membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

cell body [inference]

neuronal cell body

neuron projection terminus [inference]

axon terminus

presynapse [inference]

axon terminus

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
transcription cis-regulatory region binding	ISO	GO_REF
transcription cis-regulatory region binding	IEA	GO_REF
RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISO	GO_REF GO_REF
RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	GO_REF
DNA-binding transcription factor activity, RNA polymerase II-specific	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

transcription regulatory region nucleic acid binding [inference]

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

DNA binding [inference]

double-stranded DNA binding

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

sequence-specific DNA binding [inference]

sequence-specific double-stranded DNA binding

transcription cis-regulatory region binding

RNA polymerase II transcription regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

cis-regulatory region sequence-specific DNA binding [inference]

RNA polymerase II cis-regulatory region sequence-specific DNA binding

chromatin binding

protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding

protein-containing complex binding [inference]

mediator complex binding

molecular function regulator activity [inference]

molecular function activator activity [inference]

transcription regulator activator activity

molecular function inhibitor activity [inference]

transcription regulator inhibitor activity

transcription regulator activity [inference]

DNA-binding transcription factor activity

DNA-binding transcription factor activity, RNA polymerase II-specific

DNA-binding transcription activator activity, RNA polymerase II-specific

DNA-binding transcription activator activity [inference]

DNA-binding transcription activator activity, RNA polymerase II-specific

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKLSRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSAIAMAPATVHAGPGDTATGKPGTPKGAGMTGQGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPIPPRPASVLPNTTPAGVPAPASGSRSTSPNPLEACLEAEEAGLPLQVILTPPEAPNQKSEELSLDPSFGHPQPPEVKVEGPKEELEAARAGGFSSEAVKAEPEVSASEGLLARLPAILTENTAQVCGLSTSTTEITQPQKGRKPRDLELPLSPSLLGGQGPERTPGSGTSSGLQAPGPALTPSLLPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVVLSPGPQKP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites