GlyCosmos Portal

Submissions

Synaptotagmin-2

Summary

UniProt ID: P46097
Gene Symbol: Syt2
Gene ID: 20980
Organism: Mus musculus (house mouse)

External Links

PubChem: P46097
RaftProt: P46097
Re-Glyco: P46097

Annotation

Keyword: 3D-structure Calcium Cytoplasm Cytoplasmic vesicle Differentiation Glycoprotein Metal-binding Phosphoprotein Reference proteome Repeat Synapse Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
vesicle-mediated transport	IBA	GO_REF
regulation of calcium ion-dependent exocytosis	IBA	GO_REF
cell differentiation
calcium-dependent activation of synaptic vesicle fusion	IEP	PMID
calcium-dependent activation of synaptic vesicle fusion	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

vesicle-mediated transport

cellular developmental process [inference]

cell differentiation

developmental process [inference]

cellular developmental process [inference]

cell differentiation

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

positive regulation of transport [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of vesicle fusion [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth [inference]

positive regulation of dendrite extension

regulation of dendrite extension [inference]

positive regulation of dendrite extension

positive regulation of growth [inference]

positive regulation of cell growth [inference]

positive regulation of dendrite extension

positive regulation of developmental growth [inference]

positive regulation of dendrite extension

regulation of developmental growth [inference]

positive regulation of developmental growth [inference]

positive regulation of dendrite extension

regulation of dendrite extension [inference]

positive regulation of dendrite extension

positive regulation of biological process [inference]

positive regulation of growth [inference]

positive regulation of cell growth [inference]

positive regulation of dendrite extension

positive regulation of developmental growth [inference]

positive regulation of dendrite extension

positive regulation of cellular process [inference]

positive regulation of cell growth [inference]

positive regulation of dendrite extension

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of transport [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of dendrite extension

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis [inference]

regulation of dendrite extension [inference]

positive regulation of dendrite extension

regulation of developmental growth [inference]

positive regulation of developmental growth [inference]

positive regulation of dendrite extension

regulation of dendrite extension [inference]

positive regulation of dendrite extension

positive regulation of developmental process [inference]

positive regulation of developmental growth [inference]

positive regulation of dendrite extension

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

positive regulation of cellular process [inference]

positive regulation of cell growth [inference]

positive regulation of dendrite extension

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth [inference]

positive regulation of dendrite extension

regulation of dendrite extension [inference]

positive regulation of dendrite extension

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of vesicle fusion [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle membrane organization [inference]

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of vesicle fusion [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	IDA	PMID
plasma membrane	IBA	GO_REF
axon	IDA	PMID
axon	IBA	GO_REF
synaptic vesicle membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

secretory granule membrane [inference]

chromaffin granule membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

secretory granule membrane [inference]

chromaffin granule membrane

cell junction [inference]

synapse [inference]

neuromuscular junction

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

exocytic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

exocytic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

exocytic vesicle

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
SNARE binding	IBA	GO_REF
phosphatidylserine binding	IDA	PMID
calcium ion binding	IDA	PMID
calcium-dependent phospholipid binding	ISO	GO_REF
calcium-dependent phospholipid binding	IDA	PMID PMID PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

SNARE binding

syntaxin binding

lipid binding [inference]

phospholipid binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

alcohol binding [inference]

inositol 1,3,4,5 tetrakisphosphate binding

modified amino acid binding [inference]

phosphatidylserine binding

molecular function regulator activity [inference]

molecular sensor activity [inference]

metal ion sensor activity [inference]

calcium ion sensor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRNIFKRNQEPNVAPATTTATMPLAPVAPADNSTESTGPGESQEDMFAKLKEKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELAGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites