GlyCosmos Portal

Submissions

Radiation-inducible immediate-early gene IEX-1

Summary

UniProt ID: P46694
Gene Symbol: Ier3 Gly96 Iex1
Gene ID: 15937
Organism: Mus musculus (house mouse)

External Links

PubChem: P46694
Re-Glyco: P46694

Annotation

Keyword: Glycoprotein Phosphoprotein Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
response to protozoan	IMP	PMID
negative regulation of systemic arterial blood pressure	IMP	PMID
regulation of DNA repair	IMP	PMID
DNA damage response	ISO	GO_REF
cellular response to DNA damage stimulus	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

DNA integrity checkpoint signaling [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

signal transduction in response to DNA damage [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

cell cycle process [inference]

mitotic cell cycle process [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

intrinsic apoptotic signaling pathway in response to DNA damage

signal transduction in response to DNA damage [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to protozoan

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

intrinsic apoptotic signaling pathway in response to DNA damage

signal transduction in response to DNA damage [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to protozoan

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to protozoan

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to DNA damage stimulus

intrinsic apoptotic signaling pathway in response to DNA damage

signal transduction in response to DNA damage [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of intracellular transport [inference]

regulation of nucleocytoplasmic transport

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

regulation of nucleocytoplasmic transport

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycolytic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

DNA integrity checkpoint signaling [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

regulation of cellular response to stress [inference]

regulation of DNA repair

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

DNA integrity checkpoint signaling [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

signal transduction in response to DNA damage [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway [inference]

intrinsic apoptotic signaling pathway in response to DNA damage

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycolytic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

regulation of nucleotide catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

regulation of carbohydrate catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

regulation of generation of precursor metabolites and energy [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

regulation of phosphorus metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of DNA metabolic process [inference]

regulation of DNA repair

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of small molecule metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of primary metabolic process [inference]

regulation of carbohydrate metabolic process [inference]

regulation of carbohydrate catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycolytic process

regulation of nucleobase-containing compound metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide catabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of ATP metabolic process [inference]

regulation of glycolytic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

regulation of DNA metabolic process [inference]

regulation of DNA repair

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of reactive oxygen species metabolic process

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycolytic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide catabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide catabolic process [inference]

negative regulation of glycolytic process

negative regulation of ATP metabolic process [inference]

negative regulation of glycolytic process

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

DNA integrity checkpoint signaling [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of mitochondrion organization [inference]

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of cell cycle [inference]

regulation of mitotic cell cycle [inference]

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

regulation of mitotic cell cycle phase transition [inference]

regulation of G2/M transition of mitotic cell cycle [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

regulation of cell cycle process [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

DNA integrity checkpoint signaling [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

regulation of cell cycle phase transition [inference]

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

DNA integrity checkpoint signaling [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

regulation of mitotic cell cycle phase transition [inference]

regulation of G2/M transition of mitotic cell cycle [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

regulation of cell cycle G2/M phase transition [inference]

regulation of G2/M transition of mitotic cell cycle [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cell cycle [inference]

negative regulation of cell cycle process [inference]

negative regulation of cell cycle phase transition [inference]

cell cycle checkpoint signaling [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

DNA integrity checkpoint signaling [inference]

DNA damage checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of cell cycle G2/M phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle [inference]

mitotic cell cycle checkpoint signaling [inference]

mitotic DNA integrity checkpoint signaling [inference]

mitotic DNA damage checkpoint signaling [inference]

mitotic G2 DNA damage checkpoint signaling

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

negative regulation of mitotic cell cycle phase transition [inference]

negative regulation of G2/M transition of mitotic cell cycle [inference]

mitotic G2/M transition checkpoint [inference]

mitotic G2 DNA damage checkpoint signaling

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

regulation of nucleocytoplasmic transport

regulation of cellular response to stress [inference]

regulation of DNA repair

regulation of biological quality [inference]

regulation of blood pressure [inference]

negative regulation of blood pressure [inference]

negative regulation of systemic arterial blood pressure

regulation of membrane permeability [inference]

regulation of mitochondrial membrane permeability [inference]

negative regulation of mitochondrial membrane permeability [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

negative regulation of membrane permeability [inference]

negative regulation of mitochondrial membrane permeability [inference]

negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF
nucleus	IDA	PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF
mitochondrion

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCHSRNHLHTMTGLRAPSPAPSTGPELRRGSGPEIFTFDPLPERAVVSTARLNTSRGHRKRSRRVLYPRVVRRQLPTEEPNIAKRVLFLLFAIIFCQILMAEEGVSQPLAPEDATSAVTPEPISAPITAPPVLEPLNLTSESSDYALDLKAFLQQHPAAF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
137	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements