GlyCosmos Portal

Submissions

Synaptotagmin-1

Summary

UniProt ID

P47191

Gene Symbol

SYT1

Gene ID

396083

Organism

Gallus gallus (chicken)

External Links

PubChem: P47191
Re-Glyco: P47191

Annotation

Keyword: Calcium Cytoplasm Cytoplasmic vesicle Differentiation Glycoprotein Metal-binding Palmitate Reference proteome Repeat Synapse Transmembrane helix

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
vesicle-mediated transport	IBA	GO_REF
regulation of calcium ion-dependent exocytosis	IBA	GO_REF
cell differentiation
calcium-dependent activation of synaptic vesicle fusion	IBA	GO_REF
regulation of synaptic vesicle exocytosis	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

vesicle-mediated transport

cellular developmental process [inference]

cell differentiation

developmental process [inference]

cellular developmental process [inference]

cell differentiation

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

positive regulation of transport [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of neurotransmitter transport [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of vesicle fusion [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of transport [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

positive regulation of cellular process [inference]

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of vesicle fusion [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle membrane organization [inference]

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

positive regulation of synaptic vesicle membrane organization [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of vesicle fusion [inference]

positive regulation of vesicle fusion [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

positive regulation of synaptic vesicle fusion to presynaptic active zone membrane [inference]

calcium-dependent activation of synaptic vesicle fusion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

regulation of regulated secretory pathway [inference]

regulation of neurotransmitter secretion [inference]

regulation of synaptic vesicle exocytosis

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	IBA	GO_REF
axon	IBA	GO_REF
synaptic vesicle membrane	IBA	GO_REF
synaptic vesicle membrane	IEA	GO_REF
dense core granule	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

secretory granule membrane [inference]

chromaffin granule membrane

bounding membrane of organelle [inference]

transport vesicle membrane [inference]

exocytic vesicle membrane [inference]

synaptic vesicle membrane

secretory granule membrane [inference]

chromaffin granule membrane

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

exocytic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

exocytic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle

secretory vesicle [inference]

secretory granule [inference]

dense core granule

exocytic vesicle

Displaying **all 4** entries
GO Term	Evidence Code	Reference
SNARE binding	IBA	GO_REF
calcium-dependent phospholipid binding	IBA	GO_REF
metal ion binding
calcium ion sensor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

SNARE binding

lipid binding [inference]

phospholipid binding [inference]

calcium-dependent phospholipid binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

molecular function regulator activity [inference]

molecular sensor activity [inference]

metal ion sensor activity [inference]

calcium ion sensor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVSESHHEALAAPPATTVAAALPSNVTEPAAPGGGGGKEDAFSNLKKKFMNELNKIPLPPWALIAIAIVAVLLILTCCFCLCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQPEEEVDAMLAVKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
25	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Acetylcholine Neurotransmitter Release Cycle	Gallus gallus
Cargo recognition for clathrin-mediated endocytosis	Gallus gallus
Clathrin-mediated endocytosis	Gallus gallus
Norepinephrine Neurotransmitter Release Cycle	Gallus gallus