GlyCosmos Portal

Submissions

Vasopressin V2 receptor

Summary

UniProt ID

P48044

Gene Symbol

AVPR2

Gene ID

281642

Organism

Bos taurus (domestic cattle)

External Links

PubChem: P48044
Re-Glyco: P48044

Annotation

Keyword: Cell membrane Direct protein sequencing Disulfide bond G-protein coupled receptor Glycoprotein Palmitate Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of systemic arterial blood pressure by vasopressin	IBA	GO_REF
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF
adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS	GO_REF
positive regulation of gene expression	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

multicellular organismal process [inference]

system process [inference]

circulatory system process [inference]

vascular process in circulatory system [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

renal system process [inference]

renal water transport [inference]

renal water absorption

renal absorption [inference]

renal water absorption

endocrine process [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by vasopressin

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

localization [inference]

establishment of localization [inference]

transport [inference]

fluid transport [inference]

water transport [inference]

renal water transport [inference]

renal water absorption

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of multicellular organismal process [inference]

positive regulation of vasoconstriction

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of blood circulation [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

positive regulation of multicellular organismal process [inference]

positive regulation of vasoconstriction

regulation of biological quality [inference]

regulation of blood pressure [inference]

regulation of systemic arterial blood pressure [inference]

regulation of systemic arterial blood pressure mediated by a chemical signal [inference]

regulation of systemic arterial blood pressure by hormone [inference]

regulation of systemic arterial blood pressure by vasopressin

regulation of anatomical structure size [inference]

regulation of tube size [inference]

regulation of tube diameter [inference]

blood vessel diameter maintenance [inference]

regulation of vasoconstriction [inference]

positive regulation of vasoconstriction

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	EXP	PMID PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
vasopressin receptor activity	ISS	GO_REF
vasopressin receptor activity	IBA	GO_REF
vasopressin receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

peptide receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

vasopressin receptor activity

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

vasopressin receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MFMASTTSAVPWHLSQPTPAGNGSEGELLTARDPLLAQAELALLSTVFVAVALSNGLVLGALVRRGRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAHRHGGGTHWNRPVLLAWAFSLLFSLPQLFIFAQRDVDGSGVLDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHASLGPGPVPRAGGPRRGCRPGSPAEGARVSAAVAKTVKMTLVIVIVYVLCWAPFFLVQLWAAWDPEAPREGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCTWRRAPPSPGPQEESCATASSFLAKDTPS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
22	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Cargo recognition for clathrin-mediated endocytosis	Bos taurus
Clathrin-mediated endocytosis	Bos taurus
G alpha (s) signalling events	Bos taurus
Vasopressin regulates renal water homeostasis via Aquaporins	Bos taurus
Vasopressin-like receptors	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements