GlyCosmos Portal

Submissions

Acetylcholine receptor subunit beta-type acr-2

Summary

UniProt ID: P48182
Gene Symbol: K11G12.2 acr-2
Gene ID: 180936
Organism: Caenorhabditis elegans

External Links

Re-Glyco: P48182

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein Ligand-gated ion channel Postsynaptic cell membrane Receptor Reference proteome Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
regulation of muscle contraction	IMP	PMID PMID
regulation of muscle contraction	IGI	PMID PMID
chemical synaptic transmission
neuromuscular synaptic transmission	IMP	PMID
neuromuscular synaptic transmission	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

neuromuscular synaptic transmission

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

calcium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

calcium ion import across plasma membrane

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

calcium ion transport [inference]

calcium ion import [inference]

calcium ion import across plasma membrane

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

calcium ion import across plasma membrane

calcium ion import into cytosol [inference]

calcium ion import across plasma membrane

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

calcium ion import across plasma membrane

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

calcium ion import across plasma membrane

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

calcium ion transmembrane transport [inference]

calcium ion transmembrane import into cytosol [inference]

calcium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

calcium ion import across plasma membrane

import into cell [inference]

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

calcium ion import across plasma membrane

biological regulation [inference]

regulation of biological process [inference]

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission

neuromuscular synaptic transmission

regulation of locomotion

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

post-transcriptional regulation of gene expression [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of protein metabolic process [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of translation [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of translation

positive regulation of protein metabolic process [inference]

positive regulation of translation

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction

regulation of biological quality [inference]

regulation of membrane potential

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF
acetylcholine-gated channel complex	IBA	GO_REF
neuron projection	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

plasma membrane signaling receptor complex [inference]

acetylcholine-gated channel complex

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

acetylcholine-gated channel complex

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

acetylcholine-gated channel complex

transporter complex [inference]

transmembrane transporter complex [inference]

monoatomic ion channel complex [inference]

acetylcholine-gated channel complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

synaptic membrane [inference]

postsynaptic membrane

cell junction [inference]

synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

Displaying **all 5** entries
GO Term	Evidence Code	Reference
transmembrane signaling receptor activity	IEA	GO_REF
excitatory extracellular ligand-gated monoatomic ion channel activity	IDA	PMID
acetylcholine-gated monoatomic cation-selective channel activity	IDA	PMID
acetylcholine-gated monoatomic cation-selective channel activity	IEA	GO_REF GO_REF
transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity [inference]

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

gated channel activity [inference]

ligand-gated channel activity [inference]

ligand-gated monoatomic ion channel activity [inference]

extracellular ligand-gated monoatomic ion channel activity [inference]

excitatory extracellular ligand-gated monoatomic ion channel activity

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

acetylcholine-gated monoatomic cation-selective channel activity

ligand-gated monoatomic cation channel activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

transmitter-gated channel activity [inference]

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

acetylcholine-gated monoatomic cation-selective channel activity

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity

neurotransmitter receptor activity [inference]

transmitter-gated channel activity [inference]

transmitter-gated monoatomic ion channel activity [inference]

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

acetylcholine-gated monoatomic cation-selective channel activity

postsynaptic neurotransmitter receptor activity [inference]

acetylcholine-gated monoatomic cation-selective channel activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKKTVKILLILITVFLKVHCNGGHDDEAADFLSHTNIDDPNNSSDPNKNSDQGDTMGEDEDRLVIDLFREYNFLIRPVKNVSSPPVVVDFGVAMILLINVDEKNQILQTNVWLTMKWNDFQLAWNPAEYGNISNLHVPSDRVWLPDIVLFNNADGNYEVSFKSNVFVDHHGDVTWVPPAMFKSSCRIDVEWFPFDEQCCTLVFGSWTYNSEEVRLHWYNNIQAVQLHDYSYSGIWDVIDVPGQLVHKPDLKENKMVFNVVIRRKTLFYTVILIIPTVLMAFLSVMAFYLPVDSGEKVSLTISLLLALVVFLLLVSKILPPTSNIPLMGKYLLLAFVLNITAVVGTVVIVNIYFRSALSHKMPTWVRKVFLEFLPHLLVMKRPERIPIFNGYFVEEYCASEIFDASLVMPSMTATMLPFLQVTTNLKAASSTSSGQSSEHHENCSKWKKRLSIRMSKRRAPRARLDDDSEDIIDDTNGNHVDSLQEKISKEMKTTVEAIAYIAEHMKREMSLKKMRDDWKYVAMVLDRLILLIFFGVTLGGTLGIICSAPHVFDFVDQEAIISKLNAKYLPSDMYS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
41	N-linked (GlcNAc...) asparagine	UniProt
42	N-linked (GlcNAc...) asparagine	UniProt
80	N-linked (GlcNAc...) asparagine	UniProt
131	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Highly calcium permeable nicotinic acetylcholine receptors	Caenorhabditis elegans
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors	Caenorhabditis elegans
Highly sodium permeable postsynaptic acetylcholine nicotinic receptors	Caenorhabditis elegans
Neutrophil degranulation	Caenorhabditis elegans

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements