GlyCosmos Portal

Submissions

Fibroblast growth factor 5

Summary

UniProt ID: P48807
Gene Symbol: Fgf-5 Fgf5
Gene ID: 60662
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P48807
Re-Glyco: P48807

Annotation

Keyword: Alternative splicing Glycoprotein Growth factor Mitogen Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of cell population proliferation	ISO	GO_REF
positive regulation of cell population proliferation	IBA	GO_REF
fibroblast growth factor receptor signaling pathway	ISO	GO_REF
fibroblast growth factor receptor signaling pathway	IBA	GO_REF
glial cell differentiation	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

signal transduction involved in regulation of gene expression

cellular developmental process [inference]

cell differentiation [inference]

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell division

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

signal transduction involved in regulation of gene expression

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell division

regulation of cell division [inference]

positive regulation of cell division

regulation of cell motility [inference]

regulation of cell migration

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cytoplasm	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
fibroblast growth factor receptor binding	ISO	GO_REF
fibroblast growth factor receptor binding	IBA	GO_REF
nerve growth factor receptor binding	TAS	PMID
growth factor activity	IDA	PMID
growth factor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

neurotrophin receptor binding [inference]

nerve growth factor receptor binding

tumor necrosis factor receptor superfamily binding [inference]

death receptor binding [inference]

nerve growth factor receptor binding

growth factor receptor binding [inference]

fibroblast growth factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSLSLLFLIFCSHLILSAPAQGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFASSSASSPVAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPRPWKPKVPLSPSRRSPSPVKYRLKFRFG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
108	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 24 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
Downstream signaling of activated FGFR1	Rattus norvegicus
FGFR1c ligand binding and activation	Rattus norvegicus
FGFR2c ligand binding and activation	Rattus norvegicus
FGFR3c ligand binding and activation	Rattus norvegicus
FGFRL1 modulation of FGFR1 signaling	Rattus norvegicus
FRS-mediated FGFR1 signaling	Rattus norvegicus
FRS-mediated FGFR2 signaling	Rattus norvegicus
FRS-mediated FGFR3 signaling	Rattus norvegicus
Negative regulation of FGFR1 signaling	Rattus norvegicus
Negative regulation of FGFR2 signaling	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements