GlyCosmos Portal

Submissions

Urokinase plasminogen activator surface receptor

Summary

UniProt ID: P49616
Gene Symbol: Plaur
Gene ID: 50692
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P49616
Re-Glyco: P49616

Annotation

Keyword: Alternative splicing Cell membrane Disulfide bond GPI-anchor Receptor Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
spermatogenesis	IEP	PMID
regulation of cell adhesion	ISO	GO_REF
positive regulation of homotypic cell-cell adhesion	ISO	GO_REF
negative regulation of apoptotic process	ISO	GO_REF
negative regulation of apoptotic process	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in prostate gland development

mesenchymal cell differentiation

reproductive process [inference]

developmental process involved in reproduction [inference]

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

developmental process [inference]

developmental process involved in reproduction [inference]

anatomical structure development [inference]

regeneration [inference]

tissue regeneration [inference]

skeletal muscle tissue regeneration

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation [inference]

epithelial cell differentiation involved in prostate gland development

mesenchymal cell differentiation

growth [inference]

developmental growth [inference]

tissue regeneration [inference]

skeletal muscle tissue regeneration

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of ERBB signaling pathway [inference]

regulation of epidermal growth factor receptor signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

regulation of intracellular signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of cell adhesion

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

regulation of homotypic cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of ERBB signaling pathway [inference]

positive regulation of epidermal growth factor receptor signaling pathway

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of homotypic cell-cell adhesion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

regulation of mitochondrion organization [inference]

regulation of release of cytochrome c from mitochondria [inference]

positive regulation of release of cytochrome c from mitochondria

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of release of cytochrome c from mitochondria

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	EXP	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

protein complex involved in cell adhesion [inference]

protein complex involved in cell-matrix adhesion

catalytic complex [inference]

peptidase complex [inference]

serine-type peptidase complex [inference]

serine-type endopeptidase complex

endopeptidase complex [inference]

serine-type endopeptidase complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane

Displaying **all 5** entries
GO Term	Evidence Code	Reference
signaling receptor binding	ISO	GO_REF
enzyme binding	ISO	GO_REF
protein domain specific binding	ISO	GO_REF
urokinase plasminogen activator receptor activity	ISO	GO_REF
urokinase plasminogen activator receptor activity	TAS	PMID

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

molecular transducer activity [inference]

signaling receptor activity [inference]

urokinase plasminogen activator receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGLLRRRLLLLVVVVTTCVPASQGLRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTGGAPGPGPAHLILIASLLLTLRLWGIPLWT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	Description	Source
76	N-linked (GlcNAc...) asparagine	UniProt
184	N-linked (GlcNAc...) asparagine	UniProt
194	N-linked (GlcNAc...) asparagine	UniProt
222	N-linked (GlcNAc...) asparagine	UniProt
255	N-linked (GlcNAc...) asparagine	UniProt
283	N-linked (GlcNAc...) asparagine	UniProt
290	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Attachment of GPI anchor to uPAR	Rattus norvegicus
Dissolution of Fibrin Clot	Rattus norvegicus
FXIIa activates plasma kallikrein-kinin system	Rattus norvegicus
Neutrophil degranulation	Rattus norvegicus
Regulation of FXIIa and plasma kallikrein activity	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements