GlyCosmos Portal

Submissions

Glycogen synthase kinase-3 beta

Summary

UniProt ID: P49841
Gene Symbol: GSK3B
Gene ID: 2932
Organism: Homo sapiens (human)

External Links

PubChem: P49841
The Human Metabolome Database: HMDBP01162
The O-GlcNAc Database: P49841
RaftProt: P49841
O-GlcNAcAtlas: P49841
Re-Glyco: P49841

Annotation

Keyword: 3D-structure ADP-ribosylation ATP-binding Alternative splicing Alzheimer disease Biological rhythms Cell membrane Cytoplasm Developmental protein Diabetes mellitus Differentiation Glycogen metabolism Neurogenesis Nucleus Palmitate Phosphoprotein Proteomics identification Reference proteome Serine/threonine-protein kinase Signal transduction inhibitor Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of **114** in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
epithelial to mesenchymal transition	IMP	PMID
positive regulation of cell-matrix adhesion	IMP	PMID
heart valve development	ISS	GO_REF
glycogen metabolic process	IDA	PMID
protein phosphorylation	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

establishment or maintenance of cell polarity [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin receptor signaling pathway

Wnt signaling pathway

canonical Wnt signaling pathway

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway in absence of ligand

beta-arrestin-dependent dopamine receptor signaling pathway

intracellular signal transduction

ER-nucleus signaling pathway [inference]

ER overload response

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway in absence of ligand

metabolic process [inference]

generation of precursor metabolites and energy [inference]

energy derivation by oxidation of organic compounds [inference]

energy reserve metabolic process [inference]

glycogen metabolic process

phosphate-containing compound metabolic process [inference]

phosphorylation [inference]

protein phosphorylation

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

glucan metabolic process [inference]

glycogen metabolic process

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent macromolecule catabolic process [inference]

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein modification process [inference]

protein phosphorylation

peptidyl-amino acid modification [inference]

peptidyl-serine modification [inference]

peptidyl-serine phosphorylation

macromolecule modification [inference]

protein modification process [inference]

protein phosphorylation

peptidyl-amino acid modification [inference]

peptidyl-serine modification [inference]

peptidyl-serine phosphorylation

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

glucan metabolic process [inference]

glycogen metabolic process

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

modification-dependent protein catabolic process [inference]

ubiquitin-dependent protein catabolic process [inference]

proteasome-mediated ubiquitin-dependent protein catabolic process

protein modification process [inference]

protein phosphorylation

peptidyl-amino acid modification [inference]

peptidyl-serine modification [inference]

peptidyl-serine phosphorylation

cellular developmental process [inference]

cell differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

ER overload response

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to biotic stimulus [inference]

ER overload response

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

viral process [inference]

viral protein processing

developmental process [inference]

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

cellular developmental process [inference]

cell differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition

rhythmic process [inference]

circadian rhythm

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

ER overload response

response to biotic stimulus [inference]

cellular response to biotic stimulus [inference]

ER overload response

response to chemical [inference]

response to lipid [inference]

response to retinoic acid [inference]

cellular response to retinoic acid

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

response to peptide [inference]

response to cytokine [inference]

response to interleukin-3 [inference]

cellular response to interleukin-3

cellular response to cytokine stimulus [inference]

cellular response to interleukin-3

response to nitrogen compound [inference]

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

response to amyloid-beta [inference]

cellular response to amyloid-beta

response to oxygen-containing compound [inference]

response to retinoic acid [inference]

cellular response to retinoic acid

cellular response to oxygen-containing compound [inference]

response to amyloid-beta [inference]

cellular response to amyloid-beta

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress

ER overload response

cellular response to chemical stimulus [inference]

cellular response to lipid [inference]

cellular response to retinoic acid

cellular response to nitrogen compound [inference]

cellular response to amyloid-beta

cellular response to oxygen-containing compound [inference]

cellular response to biotic stimulus [inference]

ER overload response

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

regulation of TORC2 signaling [inference]

negative regulation of TORC2 signaling

regulation of calcium-mediated signaling [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

regulation of calcineurin-mediated signaling [inference]

regulation of calcineurin-NFAT signaling cascade [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of extrinsic apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway via death domain receptors [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of long-term synaptic potentiation

presynaptic modulation of chemical synaptic transmission

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization [inference]

regulation of protein transport [inference]

regulation of intracellular protein transport [inference]

regulation of protein export from nucleus

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of protein localization to nucleus [inference]

negative regulation of protein localization to nucleus

regulation of protein localization to cilium [inference]

positive regulation of protein localization to cilium

negative regulation of protein localization [inference]

negative regulation of protein localization to nucleus

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of protein localization to centrosome [inference]

positive regulation of protein localization to centrosome

regulation of transport [inference]

regulation of intracellular transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of intracellular protein transport [inference]

regulation of protein export from nucleus

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of nucleocytoplasmic transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

regulation of protein export from nucleus

positive regulation of protein export from nucleus

positive regulation of transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of protein transport [inference]

regulation of intracellular protein transport [inference]

regulation of protein export from nucleus

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of intracellular protein transport [inference]

regulation of protein export from nucleus

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of nucleocytoplasmic transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

regulation of protein export from nucleus

positive regulation of protein export from nucleus

regulation of growth [inference]

regulation of cell growth [inference]

regulation of extent of cell growth [inference]

regulation of axon extension

regulation of developmental growth [inference]

regulation of axon extension

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of circadian rhythm

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of intracellular transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

positive regulation of cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

positive regulation of protein-containing complex assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

positive regulation of transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

positive regulation of developmental process [inference]

positive regulation of cell differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of establishment of protein localization [inference]

positive regulation of protein transport [inference]

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

negative regulation of osteoblast differentiation

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

negative regulation of osteoblast differentiation

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

negative regulation of multicellular organismal process [inference]

negative regulation of protein localization [inference]

negative regulation of protein localization to nucleus

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

regulation of TORC2 signaling [inference]

negative regulation of TORC2 signaling

regulation of calcium-mediated signaling [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

regulation of calcineurin-mediated signaling [inference]

regulation of calcineurin-NFAT signaling cascade [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of extrinsic apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway via death domain receptors [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of cellular response to heat

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

negative regulation of osteoblast differentiation

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

positive regulation of cell differentiation

regulation of neuron differentiation [inference]

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

regulation of dopaminergic neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

regulation of type B pancreatic cell development [inference]

negative regulation of type B pancreatic cell development

regulation of stem cell differentiation [inference]

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

regulation of mesenchymal stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

regulation of developmental growth [inference]

regulation of axon extension

regulation of dendrite development [inference]

regulation of dendrite morphogenesis

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

negative regulation of osteoblast differentiation

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

insulin receptor signaling pathway

Wnt signaling pathway

canonical Wnt signaling pathway

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway in absence of ligand

beta-arrestin-dependent dopamine receptor signaling pathway

intracellular signal transduction

ER-nucleus signaling pathway [inference]

ER overload response

signal transduction in absence of ligand [inference]

extrinsic apoptotic signaling pathway in absence of ligand

apoptotic signaling pathway [inference]

extrinsic apoptotic signaling pathway

extrinsic apoptotic signaling pathway in absence of ligand

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of intracellular signal transduction [inference]

regulation of TOR signaling [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

regulation of TORC2 signaling [inference]

negative regulation of TORC2 signaling

regulation of calcium-mediated signaling [inference]

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

regulation of calcineurin-mediated signaling [inference]

regulation of calcineurin-NFAT signaling cascade [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of extrinsic apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway via death domain receptors [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

regulation of long-term synaptic potentiation

presynaptic modulation of chemical synaptic transmission

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

regulation of type I interferon production [inference]

positive regulation of type I interferon production

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

negative regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

negative regulation of macromolecule biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

regulation of carbohydrate biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of autophagy [inference]

positive regulation of autophagy

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of proteasomal protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of generation of precursor metabolites and energy [inference]

regulation of glycogen metabolic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

regulation of type I interferon production [inference]

positive regulation of type I interferon production

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

negative regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

negative regulation of macromolecule biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

regulation of polysaccharide metabolic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

regulation of glycogen metabolic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of proteasomal protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of primary metabolic process [inference]

regulation of carbohydrate metabolic process [inference]

regulation of polysaccharide metabolic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

regulation of glycogen metabolic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

regulation of carbohydrate biosynthetic process [inference]

regulation of polysaccharide biosynthetic process [inference]

regulation of glucan biosynthetic process [inference]

regulation of glycogen biosynthetic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of post-translational protein modification [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein ubiquitination [inference]

positive regulation of protein ubiquitination

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of proteasomal protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of ubiquitin-dependent protein catabolic process [inference]

regulation of proteasomal ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion [inference]

positive regulation of cell-matrix adhesion

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion

regulation of microtubule-based process

regulation of microtubule cytoskeleton organization

regulation of microtubule anchoring at centrosome

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of extrinsic apoptotic signaling pathway [inference]

regulation of extrinsic apoptotic signaling pathway via death domain receptors [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

regulation of cilium assembly [inference]

positive regulation of cilium assembly

regulation of organelle assembly [inference]

regulation of cilium assembly [inference]

positive regulation of cilium assembly

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

negative regulation of osteoblast differentiation

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

positive regulation of cell differentiation

regulation of neuron differentiation [inference]

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

regulation of dopaminergic neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

regulation of type B pancreatic cell development [inference]

negative regulation of type B pancreatic cell development

regulation of stem cell differentiation [inference]

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

regulation of mesenchymal stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of catabolic process [inference]

positive regulation of autophagy

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein ubiquitination

positive regulation of protein catabolic process

positive regulation of proteasomal protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of ubiquitin-dependent protein catabolic process [inference]

positive regulation of proteasomal ubiquitin-dependent protein catabolic process

positive regulation of intracellular transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

positive regulation of cell differentiation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

positive regulation of protein-containing complex assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of carbohydrate metabolic process [inference]

negative regulation of glycogen metabolic process [inference]

negative regulation of glycogen biosynthetic process

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of intracellular signal transduction [inference]

negative regulation of TOR signaling

negative regulation of TORC2 signaling

negative regulation of calcium-mediated signaling [inference]

negative regulation of calcineurin-mediated signaling [inference]

negative regulation of calcineurin-NFAT signaling cascade

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway [inference]

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of type B pancreatic cell development

negative regulation of neuron differentiation [inference]

negative regulation of dopaminergic neuron differentiation

negative regulation of osteoblast differentiation

negative regulation of stem cell differentiation [inference]

negative regulation of mesenchymal stem cell differentiation

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cellular component organization [inference]

regulation of cell growth [inference]

regulation of extent of cell growth [inference]

regulation of axon extension

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

regulation of cell projection assembly [inference]

regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

regulation of cilium assembly [inference]

positive regulation of cilium assembly

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development

regulation of axonogenesis

regulation of dendrite development [inference]

regulation of dendrite morphogenesis

regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

regulation of cilium assembly [inference]

positive regulation of cilium assembly

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

regulation of mitochondrion organization [inference]

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of cytoskeleton organization [inference]

regulation of microtubule cytoskeleton organization

regulation of microtubule anchoring at centrosome

regulation of organelle assembly [inference]

regulation of cilium assembly [inference]

positive regulation of cilium assembly

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

regulation of protein-containing complex assembly [inference]

negative regulation of cellular component organization [inference]

negative regulation of protein-containing complex assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

positive regulation of organelle assembly [inference]

positive regulation of cilium assembly

positive regulation of protein-containing complex assembly

positive regulation of cell projection organization [inference]

positive regulation of plasma membrane bounded cell projection assembly [inference]

positive regulation of cilium assembly

regulation of cellular localization [inference]

regulation of intracellular transport [inference]

positive regulation of intracellular transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of intracellular protein transport [inference]

regulation of protein export from nucleus

positive regulation of protein export from nucleus

positive regulation of intracellular protein transport [inference]

positive regulation of protein export from nucleus

regulation of nucleocytoplasmic transport [inference]

positive regulation of nucleocytoplasmic transport [inference]

positive regulation of protein export from nucleus

regulation of protein export from nucleus

positive regulation of protein export from nucleus

regulation of cellular response to stress [inference]

regulation of cellular response to heat

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

regulation of type I interferon production [inference]

positive regulation of type I interferon production

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type I interferon production

negative regulation of multicellular organismal process [inference]

regulation of biological quality [inference]

regulation of membrane potential [inference]

regulation of postsynaptic membrane potential [inference]

excitatory postsynaptic potential

regulation of synaptic plasticity [inference]

regulation of long-term synaptic potentiation

regulation of membrane permeability [inference]

regulation of mitochondrial membrane permeability [inference]

positive regulation of mitochondrial membrane permeability [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

positive regulation of membrane permeability [inference]

positive regulation of mitochondrial membrane permeability [inference]

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway

regulation of molecular function [inference]

negative regulation of molecular function [inference]

negative regulation of catalytic activity [inference]

negative regulation of glycogen (starch) synthase activity

positive regulation of molecular function [inference]

positive regulation of binding [inference]

positive regulation of protein binding

regulation of catalytic activity [inference]

negative regulation of catalytic activity [inference]

negative regulation of glycogen (starch) synthase activity

regulation of transferase activity [inference]

regulation of glycogen (starch) synthase activity [inference]

negative regulation of glycogen (starch) synthase activity

regulation of binding [inference]

regulation of protein binding [inference]

positive regulation of protein binding

positive regulation of binding [inference]

positive regulation of protein binding

Displaying entries **1 - 5** of 32 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	EXP	PMID
nucleus	IDA	PMID PMID PMID
nucleus	IEA	GO_REF GO_REF
nucleoplasm	TAS	Reactome Reactome Reactome Reactome Reactome Reactome
nucleoplasm	IDA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

intracellular protein-containing complex [inference]

beta-catenin destruction complex

catalytic complex [inference]

beta-catenin destruction complex

Wnt signalosome

cellular anatomical structure [inference]

microtubule organizing center [inference]

centrosome

cytosol

membrane [inference]

plasma membrane

cell junction [inference]

synapse [inference]

glutamatergic synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
protease binding	IPI	PMID
p53 binding	IDA	PMID
protein kinase activity	TAS	PMID PMID PMID
protein kinase activity	IMP	PMID PMID
protein kinase activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity

protein kinase activity

protein serine/threonine kinase activity

tau-protein kinase activity

protein serine kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity

protein serine/threonine kinase activity

tau-protein kinase activity

protein serine kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity

protein serine/threonine kinase activity

tau-protein kinase activity

protein serine kinase activity

binding [inference]

protein binding [inference]

cytoskeletal protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding

NF-kappaB binding

enzyme binding [inference]

protease binding

kinase binding [inference]

protein kinase binding

protein kinase A catalytic subunit binding

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

protein kinase A binding [inference]

protein kinase A catalytic subunit binding

scaffold protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying entries **1 - 10** of 24 in total

1

2

3

Next ›

Last »
Position	PubMed ID	GlyTouCan ID	Source
7	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
8	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
21	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
38	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
39	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
43	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
55	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
309	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
363	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database
364	22687243 24144119 28510447 29196265 29485866 34019948 38253038 38788673 40596516	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 26 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
AKT phosphorylates targets in the cytosol	Homo sapiens
APC truncation mutants have impaired AXIN binding	Homo sapiens
AXIN missense mutants destabilize the destruction complex	Homo sapiens
B-WICH complex positively regulates rRNA expression	Homo sapiens
Beta-catenin phosphorylation cascade	Homo sapiens
CRMPs in Sema3A signaling	Homo sapiens
CTNNB1 S33 mutants aren't phosphorylated	Homo sapiens
CTNNB1 S37 mutants aren't phosphorylated	Homo sapiens
CTNNB1 S45 mutants aren't phosphorylated	Homo sapiens
CTNNB1 T41 mutants aren't phosphorylated	Homo sapiens

Human Protein Atlas

ENSG00000082701

Tissue with high expression from Human Protein Atlas. Tissues that are highly expressed are highlighted.

Data available from v23.0.proteinatlas.org. Image credit: Human Protein Atlas

Disease

Displaying **all 5** entries
DO ID	Disease Name	Source
DOID:0050866	oral squamous cell carcinoma	Alliance of Genome Resources
DOID:10652	Alzheimer's disease	Alliance of Genome Resources
DOID:5419	schizophrenia	Alliance of Genome Resources
DOID:332	amyotrophic lateral sclerosis	Alliance of Genome Resources
DOID:3312	bipolar disorder	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements