GlyCosmos Portal

Submissions

Pro-cathepsin H

Summary

UniProt ID: P49935
Gene Symbol: Ctsh
Gene ID: 13036
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003655
PubChem: P49935
Re-Glyco: P49935

Annotation

Keyword: Disulfide bond Glycoprotein Lysosome Reference proteome Signal Thiol protease Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 49 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
metanephros development	ISS	GO_REF
metanephros development	IEA	GO_REF
T cell mediated cytotoxicity	IGI	PMID
immune response-regulating signaling pathway	ISS	GO_REF
immune response-regulating signaling pathway	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

leukocyte mediated immunity [inference]

leukocyte mediated cytotoxicity [inference]

T cell mediated cytotoxicity

lymphocyte mediated immunity [inference]

T cell mediated immunity [inference]

T cell mediated cytotoxicity

immune response

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T cell mediated immunity [inference]

T cell mediated cytotoxicity

cellular process [inference]

cell killing [inference]

leukocyte mediated cytotoxicity [inference]

T cell mediated cytotoxicity

signal transduction [inference]

immune response-regulating signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

metabolic process [inference]

peptide metabolic process [inference]

peptide catabolic process [inference]

neuropeptide catabolic process

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

bradykinin catabolic process

peptide catabolic process [inference]

neuropeptide catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

protein metabolic process [inference]

proteolysis

protein processing [inference]

zymogen activation

membrane protein proteolysis

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

protein maturation [inference]

protein processing [inference]

zymogen activation

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

protein processing [inference]

zymogen activation

membrane protein proteolysis

protein catabolic process [inference]

protein catabolic process in the vacuole [inference]

lysosomal protein catabolic process

protein maturation [inference]

protein processing [inference]

zymogen activation

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to thyroid hormone stimulus

reproductive process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

multicellular organismal reproductive process [inference]

gamete generation [inference]

male gamete generation [inference]

spermatogenesis

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

developmental process [inference]

developmental process involved in reproduction [inference]

spermatogenesis

anatomical structure morphogenesis [inference]

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

dichotomous subdivision of an epithelial terminal unit [inference]

dichotomous subdivision of terminal units involved in lung branching

anatomical structure development [inference]

animal organ development [inference]

kidney development [inference]

metanephros development

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

chemical homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

response to stimulus [inference]

immune response

adaptive immune response [inference]

adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains [inference]

T cell mediated immunity [inference]

T cell mediated cytotoxicity

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to thyroid hormone stimulus

response to thyroid hormone [inference]

cellular response to thyroid hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to thyroid hormone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus [inference]

cellular response to thyroid hormone stimulus

response to thyroid hormone [inference]

cellular response to thyroid hormone stimulus

response to lipid [inference]

response to retinoic acid

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to thyroid hormone stimulus

response to oxygen-containing compound [inference]

response to retinoic acid

response to odorant

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus [inference]

cellular response to thyroid hormone stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration

positive regulation of cell migration

positive regulation of epithelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

MAPK cascade [inference]

ERK1 and ERK2 cascade

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of apoptotic signaling pathway

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of apoptotic signaling pathway

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration

positive regulation of cell migration

positive regulation of epithelial cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of epithelial cell migration

regulation of multicellular organismal process [inference]

regulation of epithelial cell migration [inference]

positive regulation of epithelial cell migration

regulation of biological quality [inference]

regulation of protein stability [inference]

protein destabilization

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
outer dense fiber	ISO	GO_REF
outer dense fiber	IEA	GO_REF
acrosomal vesicle	ISO	GO_REF
acrosomal vesicle	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

lamellar body [inference]

alveolar lamellar body

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

lamellar body [inference]

alveolar lamellar body

membraneless organelle [inference]

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

secretory vesicle [inference]

secretory granule [inference]

acrosomal vesicle

lamellar body [inference]

alveolar lamellar body

intracellular membraneless organelle [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

supramolecular complex [inference]

ribonucleoprotein granule [inference]

cytoplasmic ribonucleoprotein granule

supramolecular polymer [inference]

supramolecular fiber [inference]

polymeric cytoskeletal fiber [inference]

outer dense fiber

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
endopeptidase activity	ISS	GO_REF
endopeptidase activity	ISO	GO_REF
endopeptidase activity	IMP	PMID
endopeptidase activity	IEA	GO_REF
aminopeptidase activity	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity

endopeptidase activity

cysteine-type peptidase activity

cysteine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

exopeptidase activity [inference]

aminopeptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity [inference]

serine-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity

endopeptidase activity

cysteine-type peptidase activity

cysteine-type endopeptidase activity

serine-type peptidase activity [inference]

serine-type endopeptidase activity

exopeptidase activity [inference]

aminopeptidase activity

binding [inference]

protein binding [inference]

hormone binding [inference]

thyroid hormone binding

protein-containing complex binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

MHC class I receptor activity [inference]

activating MHC class I receptor activity [inference]

HLA-A specific activating MHC class I receptor activity

immune receptor activity [inference]

MHC class I receptor activity [inference]

activating MHC class I receptor activity [inference]

HLA-A specific activating MHC class I receptor activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme activator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process

cysteine-type endopeptidase activator activity involved in apoptotic process

cysteine-type endopeptidase regulator activity involved in apoptotic process [inference]

cysteine-type endopeptidase activator activity involved in apoptotic process

peptidase regulator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process

cysteine-type endopeptidase activator activity involved in apoptotic process

molecular function activator activity [inference]

enzyme activator activity [inference]

peptidase activator activity [inference]

peptidase activator activity involved in apoptotic process

cysteine-type endopeptidase activator activity involved in apoptotic process

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWAALPLLCAGAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRNHTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACGSCWTFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
70	N-linked (GlcNAc...) asparagine	UniProt
99	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
228	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
MHC class II antigen presentation	Mus musculus
Neutrophil degranulation	Mus musculus
Surfactant metabolism	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements