GlyCosmos Portal

Submissions

Chitin deacetylase

Summary

UniProt ID: P50325
Gene Symbol: CDA
Gene ID
Organism: Amylomyces rouxii

External Links

Re-Glyco: P50325

Annotation

Keyword: Cell membrane Cell wall Cell wall biogenesis/degradation Chitin degradation Chitin-binding Cobalt Direct protein sequencing GPI-anchor Hydrolase Metal-binding Signal

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
polysaccharide catabolic process
chitin catabolic process	IEA	GO_REF
fungal-type cell wall biogenesis	IEA	GO_REF
cell wall organization

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

polysaccharide catabolic process

aminoglycan catabolic process [inference]

chitin catabolic process

carbohydrate catabolic process [inference]

polysaccharide catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

amino sugar catabolic process [inference]

glucosamine-containing compound catabolic process [inference]

chitin catabolic process

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide catabolic process

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

chitin metabolic process [inference]

chitin catabolic process

macromolecule catabolic process [inference]

polysaccharide catabolic process

aminoglycan catabolic process [inference]

chitin catabolic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide catabolic process

carbohydrate catabolic process [inference]

polysaccharide catabolic process

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

chitin metabolic process [inference]

chitin catabolic process

amino sugar metabolic process [inference]

chitin metabolic process [inference]

chitin catabolic process

amino sugar catabolic process [inference]

glucosamine-containing compound catabolic process [inference]

chitin catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

amino sugar catabolic process [inference]

glucosamine-containing compound catabolic process [inference]

chitin catabolic process

cell wall organization or biogenesis [inference]

cell wall biogenesis [inference]

fungal-type cell wall biogenesis

cell wall organization

fungal-type cell wall organization or biogenesis [inference]

fungal-type cell wall biogenesis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

external encapsulating structure organization [inference]

cell wall organization

cellular component biogenesis [inference]

cell wall biogenesis [inference]

fungal-type cell wall biogenesis

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IEA	GO_REF
side of membrane

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

side of membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
chitin deacetylase activity	ISS	GO_REF
chitin deacetylase activity	IEA	GO_REF GO_REF GO_REF GO_REF
chitin binding
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [inference]

chitin deacetylase activity

deacylase activity [inference]

deacetylase activity [inference]

chitin deacetylase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

carbohydrate derivative binding [inference]

chitin binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQIKTFALSAAIAQVATLALADTSANYWQSFTSQINPKNISIPSIEQTSSIDPTQECAYYTPDASLFTFNASEWPSIWEVATTNGMNESAEFLSVYNSIDWTKAPNISVRTLDANGNLDTTGYNTATDPDCWWTATTCTSPKISDINDDISKCPEPETWGLTYDDGPNCSHNAFYDYLQEQKLKASMFYIGSNVVDWPYGAMRGVVDGHHIASHTWSHPQMTTKTNQEVLAEFYYTQKAIKLATGLTPRYWRPPYGDIDDRVRWIASQLGLTAVIWNLDTDDWSAGVTTTVEAVEQSYSDYIAMGTNGTFANSGNIVLTHEINTTMSLAVENLPKIISAYKQVIDVATCYNISHPYFEDYEWTNVLNGTKSSATASGSATSASASGGATTAAAHIQASTSGAMSVLPNLALISAFIATLLF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 9** entries
Position	Description	Source
39	N-linked (GlcNAc...) asparagine	UniProt
70	N-linked (GlcNAc...) asparagine	UniProt
87	N-linked (GlcNAc...) asparagine	UniProt
106	N-linked (GlcNAc...) asparagine	UniProt
168	N-linked (GlcNAc...) asparagine	UniProt
307	N-linked (GlcNAc...) asparagine	UniProt
323	N-linked (GlcNAc...) asparagine	UniProt
351	N-linked (GlcNAc...) asparagine	UniProt
367	N-linked (GlcNAc...) asparagine	UniProt