GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Protein Wnt-8a

Summary

UniProt ID: P51028
Gene Symbol: wnt-8 wnt8 wnt8a
Gene ID: 30122
Organism: Danio rerio (zebrafish)

External Links

Re-Glyco: P51028

Annotation

Keyword: Developmental protein Disulfide bond Extracellular matrix Glycoprotein Lipoprotein Reference proteome Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 51 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
embryonic axis specification	IMP	PMID
eye development	IDA	PMID
eye development	IGI	PMID
mesoderm formation	IMP	PMID PMID
mesodermal cell fate commitment	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

canonical Wnt signaling pathway

cell population proliferation [inference]

cell proliferation involved in kidney development [inference]

cell proliferation involved in pronephros development

cellular developmental process [inference]

cell fate specification [inference]

stem cell fate specification [inference]

neural crest cell fate specification

cell differentiation [inference]

neuron differentiation

cell fate commitment

cell fate commitment involved in formation of primary germ layer [inference]

mesodermal cell fate commitment

cell motility [inference]

cell migration [inference]

ameboidal-type cell migration [inference]

cell migration involved in gastrulation

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

anterior/posterior pattern specification

dorsal/ventral pattern formation

determination of dorsal identity

segmentation [inference]

neural plate regionalization [inference]

neural plate anterior/posterior regionalization

axis specification [inference]

embryonic pattern specification [inference]

embryonic axis specification

neural plate pattern specification

neural plate regionalization [inference]

neural plate anterior/posterior regionalization

developmental process [inference]

anatomical structure morphogenesis [inference]

post-anal tail morphogenesis

anatomical structure formation involved in morphogenesis [inference]

formation of primary germ layer [inference]

mesoderm formation

anatomical structure development [inference]

tissue development [inference]

hindbrain development

animal organ development [inference]

sensory organ development [inference]

eye development

embryonic organ development [inference]

notochord development

system development [inference]

central nervous system development

cellular developmental process [inference]

cell fate specification [inference]

stem cell fate specification [inference]

neural crest cell fate specification

cell differentiation [inference]

neuron differentiation

cell fate commitment

cell fate commitment involved in formation of primary germ layer [inference]

mesodermal cell fate commitment

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

regulation of fibroblast growth factor receptor signaling pathway [inference]

positive regulation of fibroblast growth factor receptor signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

regulation of fibroblast growth factor receptor signaling pathway [inference]

positive regulation of fibroblast growth factor receptor signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of fibroblast growth factor receptor signaling pathway [inference]

positive regulation of fibroblast growth factor receptor signaling pathway

regulation of developmental process [inference]

regulation of anterior head development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

canonical Wnt signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

regulation of fibroblast growth factor receptor signaling pathway [inference]

positive regulation of fibroblast growth factor receptor signaling pathway

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of fibroblast growth factor receptor signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
cell surface	IDA	PMID
apoptotic body	IDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

extracellular vesicle [inference]

apoptotic body

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

apoptotic body

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

apoptotic body

Displaying **all 2** entries
GO Term	Evidence Code	Reference
frizzled binding	IBA	GO_REF
cytokine activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding [inference]

frizzled binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNPCQIFASLVMSICCHILSSTAWSVNNFLMTGPKAYLAYTSSVQAGAQSGIEECKHQFAWDRWNCPESALQLSTHKGLRSATRETAFVHAISAAGVMYTLTKNCSMGDFENCGCDDSKIGKMGGRGWVWGGCSDNVNFGDRIAKLFVDALENGHDSRAAVNLHNNEAGRLAVKATLKRTCKCHGLSGSCSIQTCWMQLADFRDIGSYLKIKHDQARKLEMDKIRMRAGNSADNRGAIADTFSAVARTELIFMEDSPDYCVKNLSMGLHGTEGRECLQSGKNLSQWERRSCRRLCHECGLKVEERRIETVSSCNCKFHWCCTVKCETCTQTVTRYFCAKRHRNRRPHNHSRKRQHTRRG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
104	N-linked (GlcNAc...) asparagine			UniProt
263	N-linked (GlcNAc...) asparagine			UniProt
282	N-linked (GlcNAc...) asparagine			UniProt
348	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Disassembly of the destruction complex and recruitment of AXIN to the membrane	Danio rerio
WNT ligand biogenesis and trafficking	Danio rerio

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026