GlyCosmos Portal

Submissions

Estradiol 17-beta-dehydrogenase 2

Summary

UniProt ID: P51658
Gene Symbol: Hsd17b2 Edh17b2
Gene ID: 15486
Organism: Mus musculus (house mouse)

External Links

GlyGen: P51658
PubChem: P51658
Re-Glyco: P51658

Annotation

Keyword: Endoplasmic reticulum NAD Oxidoreductase Reference proteome Signal-anchor Steroid biosynthesis Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
in utero embryonic development	IMP	PMID
placenta development	IMP	PMID
androgen biosynthetic process	ISO	GO_REF
androgen biosynthetic process	IBA	GO_REF
estrogen biosynthetic process	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

steroid hormone biosynthetic process [inference]

hormone biosynthetic process [inference]

hormone metabolic process [inference]

androgen metabolic process

androgen biosynthetic process

estrogen metabolic process [inference]

estrogen biosynthetic process

hormone biosynthetic process [inference]

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process

steroid biosynthetic process [inference]

steroid hormone biosynthetic process [inference]

androgen metabolic process

androgen biosynthetic process

estrogen metabolic process [inference]

estrogen biosynthetic process

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

steroid hormone biosynthetic process [inference]

multicellular organismal process [inference]

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

developmental process [inference]

anatomical structure development [inference]

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

animal organ development [inference]

placenta development

response to stimulus [inference]

response to chemical [inference]

response to lipid [inference]

response to retinoic acid

response to oxygen-containing compound [inference]

response to retinoic acid

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

androgen metabolic process

androgen biosynthetic process

estrogen metabolic process [inference]

estrogen biosynthetic process

hormone biosynthetic process [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	ISO	GO_REF
endoplasmic reticulum membrane	IBA	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
estradiol 17-beta-dehydrogenase [NAD(P)+] activity	ISS	GO_REF
estradiol 17-beta-dehydrogenase [NAD(P)+] activity	ISO	GO_REF GO_REF
estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IBA	GO_REF
estradiol 17-beta-dehydrogenase [NAD(P)+] activity	IEA	GO_REF GO_REF GO_REF
testosterone dehydrogenase (NAD+) activity	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

steroid dehydrogenase activity [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

estradiol 17-beta-dehydrogenase [NAD(P)+] activity

17-beta-hydroxysteroid dehydrogenase (NAD+) activity [inference]

testosterone dehydrogenase (NAD+) activity

oxidoreductase activity, acting on CH-OH group of donors [inference]

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

estradiol 17-beta-dehydrogenase [NAD(P)+] activity

17-beta-hydroxysteroid dehydrogenase (NAD+) activity [inference]

testosterone dehydrogenase (NAD+) activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSPFASESAWLCLAAAAVLGGTLLCGCRSGRQLRSQAVCLAGLWGGACLLSLSLLCTLFLLSVACFLLLYMSSSDQDLLPVDQKAVLVTGADSGFGHGLAKHLDKLGFTVFAGVLDKEGPGAEELRKHCSERLSVLQMDVTKPEQIKDAHSKVTEKIQDKGLWAVVNNAGVFHLPIDGELIPMSIYRKCMAVNFFGTVEVTKAFLPLLRKSKGRLVNVSSMGGTVPLQMTSAYAATKAALTMFSTIIRQELDKWGVKVVTIKPGGFKTNITGSQDIWDKMEKEILDHFSKDIQENYGQDYVHTQKLIIPTLKERSNPDITPVLRDIQHAISARNPSSFYYPGRMAYLWVCLAAYCPTSLLDYVIKKGFYPQPTPRALRTVH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
373				GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Estrogen biosynthesis	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements