GlyCosmos Portal

Submissions

Peroxisomal multifunctional enzyme type 2

Summary

UniProt ID: P51660
Gene Symbol: Hsd17b4 Edh17b4
Gene ID: 15488
Organism: Mus musculus (house mouse)

External Links

GlyGen: P51660
PubChem: P51660
RaftProt: P51660
Re-Glyco: P51660

Annotation

Keyword: Acetylation Fatty acid metabolism Isomerase Lyase NAD Oxidoreductase Peroxisome Phosphoprotein Reference proteome

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
very long-chain fatty acid metabolic process	IMP	PMID
fatty acid biosynthetic process	IDA	PMID
fatty acid biosynthetic process	IMP	PMID PMID
fatty acid beta-oxidation	ISS	GO_REF
fatty acid beta-oxidation	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

phosphorus metabolic process [inference]

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

small molecule catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

biosynthetic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process

small molecule biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

hormone metabolic process [inference]

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

fatty acid oxidation [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

steroid metabolic process [inference]

lipid biosynthetic process [inference]

fatty acid biosynthetic process

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

lipid modification [inference]

lipid oxidation [inference]

fatty acid oxidation [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

fatty acid derivative metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

small molecule metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

fatty acid oxidation [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

small molecule catabolic process [inference]

carboxylic acid catabolic process [inference]

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid beta-oxidation using acyl-CoA oxidase

small molecule biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

fatty acid biosynthetic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

purine-containing compound metabolic process [inference]

acyl-CoA metabolic process [inference]

fatty-acyl-CoA metabolic process [inference]

cellular developmental process [inference]

cell development [inference]

epithelial cell development [inference]

Sertoli cell development

reproductive process [inference]

developmental process involved in reproduction [inference]

Sertoli cell development

developmental process [inference]

developmental process involved in reproduction [inference]

Sertoli cell development

anatomical structure development [inference]

cell development [inference]

epithelial cell development [inference]

Sertoli cell development

cellular developmental process [inference]

cell development [inference]

epithelial cell development [inference]

Sertoli cell development

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	HDA	PMID PMID
peroxisome	ISS	GO_REF
peroxisome	ISO	GO_REF GO_REF
peroxisome	IDA	PMID
peroxisome	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

microbody lumen [inference]

peroxisomal matrix

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

microbody [inference]

peroxisome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

mitochondrion

microbody [inference]

peroxisome

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
(3S)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	ISO	GO_REF
(3S)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	IMP	PMID
enoyl-CoA hydratase activity	ISS	GO_REF
enoyl-CoA hydratase activity	ISO	GO_REF
enoyl-CoA hydratase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

steroid dehydrogenase activity [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

oxidoreductase activity, acting on CH-OH group of donors [inference]

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

(3S)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

(3R)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity

lyase activity [inference]

carbon-oxygen lyase activity [inference]

hydro-lyase activity [inference]

enoyl-CoA hydratase activity

3-hydroxyacyl-CoA dehydratase activity

3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase activity

isomerase activity

binding [inference]

protein binding [inference]

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MASPLRFDGRVVLVTGAGGGLGRAYALAFAERGALVIVNDLGGDFKGIGKGSSAADKVVAEIRRKGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIHRVHLRGSFQVTRAAWDHMKKQNYGRILMTSSASGIYGNFGQANYSAAKLGILGLCNTLAIEGRKNNIHCNTIAPNAGSRMTETVLPEDLVEALKPEYVAPLVLWLCHESCEENGGLFEVGAGWIGKLRWERTLGAIVRKRNQPMTPEAVRDNWEKICDFSNASKPQTIQESTGGIVEVLHKVDSEGISPNRTSHAAPAATSGFVGAVGHKLPSFSSSYTELQSIMYALGVGASVKNPKDLKFVYEGSADFSCLPTFGVIVAQKSMMNGGLAEVPGLSFNFAKALHGEQYLELYKPLPRSGELKCEAVIADILDKGSGVVIVMDVYSYSGKELICYNQFSVFVVGSGGFGGKRTSEKLKAAVAVPNRPPDAVLRDATSLNQAALYRLSGDWNPLHIDPDFASVAGFEKPILHGLCTFGFSARHVLQQFADNDVSRFKAIKVRFAKPVYPGQTLQTEMWKEGNRIHFQTKVHETGDVVISNAYVDLVPASGVSTQTPSEGGELQSALVFGEIGRRLKSVGREVVKKANAVFEWHITKGGTVAAKWTIDLKSGSGEVYQGPAKGSADVTIIISDEDFMEVVFGKLDPQKAFFSGRLKARGNIMLSQKLQMILKDYAKL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
281			G77547TA	GlyGen
310			G70619PT	GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 5** entries
Pathway Name	Organism
Beta-oxidation of pristanoyl-CoA	Mus musculus
Beta-oxidation of very long chain fatty acids	Mus musculus
Peroxisomal protein import	Mus musculus
Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol	Mus musculus
alpha-linolenic acid (ALA) metabolism	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0090031	D-bifunctional protein deficiency	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements