Submissions
GlyTouCan
Glycan Structure Repository
GlyComb
Glycoconjugate Repository
GlycoPOST
Glycomics MS raw data Repository
UniCarb-DR
Glycomics MS Repository for glycan annotations from GlycoWorkbench
LM-GlycoRepo
Repository for lectin-assisted multimodality data
All Resources
Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / OrganismsTools
SugarDrawer
GlycanBuilder
Glycan Converters
GlycoMaple
GlycomeAtlas
LM-GlycomeAtlas
GALAXY
MCAW
GlycoSim
GRable
Guidelines
MIRAGE
Tumor necrosis factor
Summary
- UniProt ID
- P51742
- Gene Symbol
- TNF TNFA TNFSF2
- Gene ID
- 403922
- Organism
- Canis lupus familiaris (dog)
Annotation
- Keyword
- 3D-structure Cell membrane Cytokine Disulfide bond Glycoprotein Myristate Phosphoprotein Reference proteome Secreted Signal-anchor Transmembrane helix
Gene Ontology (GO)
| GO Term | Evidence Code | Reference |
|---|---|---|
| negative regulation of transcription by RNA polymerase II | ||
| protein polyubiquitination |
|
|
| microglial cell activation | ||
| positive regulation of protein phosphorylation |
|
|
| negative regulation of endothelial cell proliferation |
GO Hierarchy
- positive regulation of synaptic transmission
- positive regulation of synaptic transmission
- positive regulation of nitric oxide biosynthetic process
- positive regulation of synaptic transmission
- positive regulation of hair follicle development
- positive regulation of synaptic transmission
- positive regulation of nitric oxide biosynthetic process
- positive regulation of nitric oxide biosynthetic process
- regulation of reactive oxygen species metabolic process
- positive regulation of nitric oxide biosynthetic process
- positive regulation of synaptic transmission
- positive regulation of hair follicle development
biological process
cellular process [inference]
response to stimulus [inference]
biological regulation [inference]
regulation of biological process [inference]
regulation of immune system process [inference]
positive regulation of immune system process [inference]
regulation of immune effector process [inference]
regulation of immune response [inference]
regulation of signaling [inference]
regulation of signal transduction [inference]
positive regulation of signal transduction [inference]
regulation of intracellular signal transduction [inference]
positive regulation of signaling [inference]
positive regulation of signal transduction [inference]
regulation of localization [inference]
regulation of locomotion [inference]
positive regulation of biological process [inference]
positive regulation of immune system process [inference]
positive regulation of signaling [inference]
positive regulation of signal transduction [inference]
positive regulation of cellular process [inference]
positive regulation of cell population proliferation [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of protein metabolic process [inference]
positive regulation of cell communication [inference]
positive regulation of signal transduction [inference]
positive regulation of response to stimulus [inference]
positive regulation of signal transduction [inference]
positive regulation of developmental process [inference]
positive regulation of multicellular organismal process [inference]
positive regulation of cytokine production [inference]
negative regulation of biological process [inference]
regulation of response to stimulus [inference]
regulation of signal transduction [inference]
positive regulation of signal transduction [inference]
regulation of intracellular signal transduction [inference]
regulation of response to external stimulus [inference]
positive regulation of response to stimulus [inference]
positive regulation of signal transduction [inference]
negative regulation of response to stimulus [inference]
regulation of immune response [inference]
regulation of response to stress [inference]
regulation of developmental process [inference]
regulation of anatomical structure morphogenesis [inference]
regulation of cell differentiation [inference]
positive regulation of developmental process [inference]
regulation of multicellular organismal development [inference]
regulation of cellular process [inference]
signal transduction [inference]
regulation of cell communication [inference]
regulation of signal transduction [inference]
positive regulation of signal transduction [inference]
regulation of intracellular signal transduction [inference]
positive regulation of cell communication [inference]
positive regulation of signal transduction [inference]
negative regulation of cell communication [inference]
regulation of metabolic process [inference]
regulation of biosynthetic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
regulation of cytokine production [inference]
positive regulation of cytokine production [inference]
regulation of DNA-templated transcription [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
regulation of RNA biosynthetic process [inference]
negative regulation of metabolic process [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of protein metabolic process [inference]
regulation of catabolic process [inference]
regulation of phosphorus metabolic process [inference]
regulation of macromolecule metabolic process [inference]
regulation of macromolecule biosynthetic process [inference]
regulation of gene expression [inference]
regulation of cytokine production [inference]
positive regulation of cytokine production [inference]
regulation of DNA-templated transcription [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
regulation of RNA biosynthetic process [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of protein metabolic process [inference]
negative regulation of macromolecule metabolic process [inference]
regulation of protein metabolic process [inference]
regulation of RNA metabolic process [inference]
regulation of primary metabolic process [inference]
regulation of lipid metabolic process [inference]
regulation of nucleobase-containing compound metabolic process [inference]
regulation of protein metabolic process [inference]
regulation of cell adhesion [inference]
regulation of cell population proliferation [inference]
regulation of programmed cell death [inference]
regulation of cellular component biogenesis [inference]
regulation of cell differentiation [inference]
positive regulation of cellular process [inference]
positive regulation of cell population proliferation [inference]
positive regulation of metabolic process [inference]
positive regulation of biosynthetic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of macromolecule metabolic process [inference]
positive regulation of macromolecule biosynthetic process [inference]
positive regulation of gene expression [inference]
positive regulation of cytokine production [inference]
positive regulation of protein metabolic process [inference]
positive regulation of cell communication [inference]
positive regulation of signal transduction [inference]
negative regulation of cellular process [inference]
regulation of cellular component organization [inference]
regulation of multicellular organismal process [inference]
regulation of cytokine production [inference]
positive regulation of cytokine production [inference]
positive regulation of multicellular organismal process [inference]
positive regulation of cytokine production [inference]
regulation of multicellular organismal development [inference]
| GO Term | Evidence Code | Reference |
|---|---|---|
| phagocytic cup | ||
| obsolete extracellular space |
|
|
| external side of plasma membrane | ||
| membrane raft | ||
| recycling endosome |
GO Hierarchy
| GO Term | Evidence Code | Reference |
|---|---|---|
| transcription cis-regulatory region binding | ||
| protease binding | ||
| cytokine activity | ||
| cytokine activity | ||
| tumor necrosis factor receptor binding |
Sequence
MSTESMIRDVELAEEPLPKKAGGPPGSRRCFCLSLFSFLLVAGATTLFCLLHFGVIGPQREELPNGLQLISPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVELTDNQLIVPSDGLYLIYSQVLFKGQGCPSTHVLLTHTISRFAVSYQTKVNLLSAIKSPCQRETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVYFGIIAL
Glycosylation Sites
| Position | Description | PubMed ID | GlyTouCan ID | Source |
|---|---|---|---|---|
| 80 |
|
|
Feature
: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt
Pathway
| Pathway Name | Organism |
|---|---|
| Regulation of TNFR1 signaling | Canis familiaris |
| TNF signaling | Canis familiaris |
| TNFR1-induced NF-kappa-B signaling pathway | Canis familiaris |
| TNFR1-induced proapoptotic signaling | Canis familiaris |
| TNFR1-mediated ceramide production | Canis familiaris |
| TNFR2 non-canonical NF-kB pathway | Canis familiaris |
