GlyCosmos Portal

Submissions

Gastrin-releasing peptide receptor

Summary

UniProt ID: P52500
Gene Symbol: Grpr
Gene ID: 24938
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem: P52500
Re-Glyco: P52500

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Palmitate Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor signaling pathway	IDA	PMID
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF
phospholipase C-activating G protein-coupled receptor signaling pathway	ISS	GO_REF
phospholipase C-activating G protein-coupled receptor signaling pathway	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory

behavior [inference]

motor behavior

psychomotor behavior

response to stimulus [inference]

response to external stimulus [inference]

response to external biotic stimulus

response to biotic stimulus [inference]

response to external biotic stimulus

biological process involved in intraspecies interaction between organisms [inference]

social behavior

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of behavioral fear response

positive regulation of fear response [inference]

positive regulation of behavioral fear response

positive regulation of multicellular organismal process [inference]

positive regulation of behavior [inference]

positive regulation of behavioral fear response

positive regulation of fear response [inference]

positive regulation of behavioral fear response

positive regulation of respiratory gaseous exchange

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of defense response [inference]

positive regulation of behavioral fear response

positive regulation of fear response [inference]

positive regulation of behavioral fear response

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of behavioral fear response

regulation of behavioral fear response [inference]

positive regulation of behavioral fear response

regulation of fear response [inference]

positive regulation of fear response [inference]

positive regulation of behavioral fear response

regulation of behavioral fear response [inference]

positive regulation of behavioral fear response

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

regulation of cell population proliferation

regulation of multicellular organismal process [inference]

regulation of respiratory gaseous exchange [inference]

positive regulation of respiratory gaseous exchange

regulation of behavior [inference]

positive regulation of behavior [inference]

positive regulation of behavioral fear response

regulation of behavioral fear response [inference]

positive regulation of behavioral fear response

positive regulation of multicellular organismal process [inference]

positive regulation of behavior [inference]

positive regulation of behavioral fear response

positive regulation of fear response [inference]

positive regulation of behavioral fear response

positive regulation of respiratory gaseous exchange

regulation of fear response [inference]

positive regulation of fear response [inference]

positive regulation of behavioral fear response

regulation of behavioral fear response [inference]

positive regulation of behavioral fear response

Displaying **all 5** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	EXP	PMID
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor activity	IDA	PMID
G protein-coupled receptor activity	IEA	GO_REF
bombesin receptor activity	TAS	PMID
bombesin receptor activity	IEA	GO_REF
neuropeptide receptor activity	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

peptide binding [inference]

neuropeptide binding

molecular transducer activity [inference]

signaling receptor activity [inference]

peptide receptor activity [inference]

G protein-coupled peptide receptor activity

neuropeptide receptor activity

bombesin receptor activity

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

G protein-coupled peptide receptor activity

neuropeptide receptor activity

bombesin receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDPNNCSHLNLEVDPFLSCNNTFNQTLNPPKMDNWFHPGIIYVIPAVYGLIIVIGLIGNITLIKIFCTVKSMRNVPNLFISSLALGDLLLLVTCAPVDASKYLADRWLFGRIGCKLIPFIQLTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAALIWIVSMLLAIPEAVFSDLHPFHVKDTNQTFISCAPYPHSNELHPKIHSMASFLVFYIIPLSIISVYYYFIARNLIQSAYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLHFITSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPSLLNRSHSTGRSTTCMTSFKSTNPSATFSLINGNICHEGYV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
5	N-linked (GlcNAc...) asparagine	UniProt
20	N-linked (GlcNAc...) asparagine	UniProt
24	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
G alpha (q) signalling events	Rattus norvegicus
Peptide ligand-binding receptors	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements