GlyCosmos Portal

Submissions

Ephrin-A1

Summary

UniProt ID: P52793
Gene Symbol: Efna1 Epgl1 Epl1 Lerk1
Gene ID: 13636
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB

GPDB0003682

GlyConnect

Ephrin-A1

GlyGen

P52793

PubChem

P52793

Re-Glyco

P52793

Annotation

Keyword: Angiogenesis Cell membrane Disulfide bond GPI-anchor Reference proteome Secreted Signal Tumor suppressor

Gene Ontology (GO)

Displaying entries **1 - 5** of 33 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IMP	PMID
angiogenesis
aortic valve morphogenesis	IMP	PMID
mitral valve morphogenesis	IMP	PMID
endocardial cushion to mesenchymal transition involved in heart valve formation	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-substrate adhesion [inference]

substrate adhesion-dependent cell spreading

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ephrin receptor signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition [inference]

cardiac epithelial to mesenchymal transition [inference]

endocardial cushion to mesenchymal transition [inference]

endocardial cushion to mesenchymal transition involved in heart valve formation

cell motility [inference]

cell migration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance

developmental process [inference]

anatomical structure morphogenesis [inference]

heart valve morphogenesis [inference]

aortic valve morphogenesis

atrioventricular valve morphogenesis [inference]

mitral valve morphogenesis

anatomical structure formation involved in morphogenesis [inference]

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition [inference]

cardiac epithelial to mesenchymal transition [inference]

endocardial cushion to mesenchymal transition [inference]

endocardial cushion to mesenchymal transition involved in heart valve formation

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

regulation of blood vessel endothelial cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of dendritic spine morphogenesis

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of dendritic spine development [inference]

negative regulation of dendritic spine morphogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial to mesenchymal transition

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of dendritic spine morphogenesis [inference]

negative regulation of dendritic spine morphogenesis

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of dendritic spine development [inference]

negative regulation of dendritic spine morphogenesis

regulation of dendritic spine development [inference]

negative regulation of dendritic spine development [inference]

negative regulation of dendritic spine morphogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

ephrin receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

regulation of amyloid precursor protein catabolic process [inference]

regulation of amyloid-beta formation [inference]

positive regulation of amyloid-beta formation

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

regulation of amyloid precursor protein catabolic process [inference]

regulation of amyloid-beta formation [inference]

positive regulation of amyloid-beta formation

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

regulation of cell adhesion [inference]

regulation of cell adhesion mediated by integrin

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of leukocyte apoptotic process [inference]

regulation of lymphocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of T cell apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of thymocyte apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of amyloid precursor protein catabolic process

positive regulation of amyloid-beta formation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction

positive regulation of MAPK cascade

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of MAPK cascade

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of leukocyte apoptotic process [inference]

negative regulation of lymphocyte apoptotic process [inference]

negative regulation of T cell apoptotic process [inference]

negative regulation of thymocyte apoptotic process

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of dendritic spine morphogenesis

regulation of cellular component organization [inference]

regulation of cell projection organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of dendritic spine morphogenesis

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

negative regulation of neuron projection development [inference]

negative regulation of dendritic spine morphogenesis

regulation of axonogenesis

regulation of dendritic spine morphogenesis [inference]

negative regulation of dendritic spine morphogenesis

regulation of synapse organization [inference]

regulation of postsynapse organization [inference]

regulation of dendritic spine morphogenesis [inference]

negative regulation of dendritic spine morphogenesis

negative regulation of cellular component organization [inference]

negative regulation of cell projection organization [inference]

negative regulation of neuron projection development [inference]

negative regulation of dendritic spine morphogenesis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

regulation of blood vessel endothelial cell migration

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial to mesenchymal transition

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	IEA	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

side of membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
ephrin receptor binding	ISO	GO_REF
ephrin receptor binding	IBA	GO_REF
ephrin receptor binding	IPI	PMID
ephrin receptor binding	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

ephrin receptor binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLNDYLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKLSEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQEKRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLLQSQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites