GlyCosmos Portal

Submissions

LIM domain kinase 1

Summary

UniProt ID

P53668

Gene Symbol

Limk
Limk1

Gene ID

[16885]

Organism

Mus musculus (house mouse)

External Links

GlyGen: P53668
PubChem: P53668
The O-GlcNAc Database: P53668
O-GlcNAcAtlas: P53668
Re-Glyco: P53668

Annotation

Keyword: ATP-binding Cell projection Cytoskeleton LIM domain Nucleus Phosphoprotein Reference proteome Repeat Serine/threonine-protein kinase Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
protein phosphorylation	ISS	GO_REF
protein phosphorylation	ISO	GO_REF
actin cytoskeleton organization	IBA	GO_REF
positive regulation of actin filament bundle assembly	ISO	GO_REF
positive regulation of actin filament bundle assembly	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phosphorylation [inference]

protein phosphorylation

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein phosphorylation

macromolecule modification [inference]

protein modification process [inference]

protein phosphorylation

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

protein phosphorylation

actin filament-based process [inference]

actin cytoskeleton organization

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization

biological regulation [inference]

regulation of biological process [inference]

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth [inference]

positive regulation of axon extension

regulation of extent of cell growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

positive regulation of growth [inference]

positive regulation of cell growth [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

positive regulation of axon extension

regulation of developmental growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

positive regulation of axon extension

positive regulation of biological process [inference]

positive regulation of growth [inference]

positive regulation of cell growth [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

positive regulation of axon extension

positive regulation of cellular process [inference]

positive regulation of cell growth [inference]

positive regulation of axon extension

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

positive regulation of axon extension

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of axonogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of developmental growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

positive regulation of axon extension

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of developmental growth [inference]

positive regulation of axon extension

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of cellular process [inference]

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of cellular component biogenesis [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of cellular process [inference]

positive regulation of cell growth [inference]

positive regulation of axon extension

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth [inference]

positive regulation of axon extension

regulation of extent of cell growth [inference]

regulation of axon extension [inference]

positive regulation of axon extension

regulation of cell projection organization [inference]

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of plasma membrane bounded cell projection organization [inference]

regulation of neuron projection development [inference]

regulation of axonogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of synapse organization [inference]

regulation of modification of synaptic structure [inference]

regulation of modification of postsynaptic structure [inference]

regulation of modification of postsynaptic actin cytoskeleton

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

positive regulation of cell projection organization [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly

positive regulation of stress fiber assembly

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of axonogenesis [inference]

positive regulation of axon extension

Displaying entries **1 - 5** of 26 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	ISO	GO_REF
nucleus	IDA	PMID PMID
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell junction [inference]

synapse [inference]

glutamatergic synapse

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

site of polarized growth [inference]

growth cone [inference]

axonal growth cone

cell projection [inference]

plasma membrane bounded cell projection [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

cytoskeleton

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
protein serine/threonine kinase activity	ISS	GO_REF
protein serine/threonine kinase activity	ISO	GO_REF
protein serine/threonine kinase activity	IBA	GO_REF
protein serine/threonine kinase activity	IEA	GO_REF GO_REF
ATP binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity [inference]

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity [inference]

catalytic activity, acting on a protein [inference]

protein kinase activity [inference]

binding [inference]

protein binding [inference]

enzyme binding [inference]

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

heat shock protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

cation binding [inference]

metal ion binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

ubiquitin-protein transferase inhibitor activity [inference]

ubiquitin ligase inhibitor activity

ubiquitin-protein transferase regulator activity [inference]

ubiquitin-protein transferase inhibitor activity [inference]

ubiquitin ligase inhibitor activity

molecular function inhibitor activity [inference]

enzyme inhibitor activity [inference]

ubiquitin-protein transferase inhibitor activity [inference]

ubiquitin ligase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCECSVSLSHQYYEKDGQLFCKKDYWARYGESCHGCSEHITKGLVMVAGELKYHPECFICLACGNFIGDGDTYTLVEHSKLYCGQCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASAHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDSLGHGPVSDPSPLSSPVHTPSGQAASSARQKPVLRSCSIDTSPGTSSLASPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKNMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENRNVVVADFGLARLMIDEKNQSEDLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEQWLETLRMHLSGHLPLGPQLEQLERGFWETYRRGESSLPAHPEVPD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
20		30016717	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
RHO GTPases activate PAKs	Mus musculus
Regulation of actin dynamics for phagocytic cup formation	Mus musculus
Sema3A PAK dependent Axon repulsion	Mus musculus

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:1928	Williams-Beuren syndrome	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements