GlyCosmos Portal

Submissions

Fibroblast growth factor 9

Summary

UniProt ID: P54130
Gene Symbol: Fgf9 Fgf-9
Gene ID: 14180
Organism: Mus musculus (house mouse)

External Links

PubChem: P54130
Re-Glyco: P54130

Annotation

Keyword: Developmental protein Differentiation Glycoprotein Growth factor Heparin-binding Mitogen Reference proteome Secreted

Gene Ontology (GO)

Displaying entries **1 - 5** of 60 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IMP	PMID
angiogenesis	IDA	PMID
angiogenesis	IMP	PMID PMID
osteoblast differentiation	IMP	PMID
eye development	IMP	PMID

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

cellular developmental process [inference]

cell differentiation [inference]

vasculogenesis [inference]

vasculogenesis involved in coronary vascular morphogenesis

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

reproductive process [inference]

developmental process involved in reproduction [inference]

sex determination [inference]

male sex determination

reproductive structure development [inference]

gonad development [inference]

male gonad development

developmental process [inference]

developmental process involved in reproduction [inference]

sex determination [inference]

male sex determination

reproductive structure development [inference]

gonad development [inference]

male gonad development

anatomical structure morphogenesis [inference]

cardiac chamber morphogenesis [inference]

cardiac ventricle morphogenesis [inference]

cardiac left ventricle morphogenesis

appendage morphogenesis [inference]

limb morphogenesis [inference]

embryonic limb morphogenesis

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis

embryonic morphogenesis [inference]

embryonic appendage morphogenesis [inference]

embryonic limb morphogenesis

inner ear morphogenesis

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

cardiac chamber development [inference]

cardiac ventricle development

tissue development [inference]

mesenchyme development [inference]

lung-associated mesenchyme development

tube development [inference]

digestive tract development [inference]

embryonic digestive tract development

animal organ development [inference]

sensory organ development [inference]

eye development

gonad development [inference]

male gonad development

lung development

embryonic organ development [inference]

embryonic digestive tract development

reproductive structure development [inference]

gonad development [inference]

male gonad development

system development [inference]

skeletal system development [inference]

embryonic skeletal system development

cellular developmental process [inference]

cell differentiation [inference]

vasculogenesis [inference]

vasculogenesis involved in coronary vascular morphogenesis

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

protein localization to organelle [inference]

protein localization to nucleus [inference]

protein import into nucleus

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

establishment of protein localization to organelle [inference]

protein import into nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

positive regulation of smoothened signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

signaling [inference]

cell-cell signaling

regulation of growth [inference]

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of cell motility [inference]

regulation of cell migration

regulation of smooth muscle cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

regulation of vascular associated smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of glial cell migration [inference]

regulation of Schwann cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of growth [inference]

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of mesenchymal cell proliferation

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of cell division

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

positive regulation of smoothened signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of developmental process [inference]

regulation of development, heterochronic [inference]

regulation of timing of cell differentiation

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of timing of cell differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of developmental growth [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of developmental growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of smoothened signaling pathway [inference]

positive regulation of smoothened signaling pathway

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

negative regulation of Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

regulation of vascular endothelial growth factor receptor signaling pathway [inference]

positive regulation of vascular endothelial growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of activin receptor signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of transcription, DNA-templated

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of mesenchymal cell proliferation

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of mesenchymal cell proliferation [inference]

positive regulation of mesenchymal cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

regulation of glial cell proliferation [inference]

regulation of Schwann cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of timing of cell differentiation

regulation of cell development [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of mesenchymal cell proliferation

positive regulation of smooth muscle cell proliferation [inference]

positive regulation of vascular associated smooth muscle cell proliferation

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of transcription, DNA-templated

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of Wnt signaling pathway [inference]

positive regulation of canonical Wnt signaling pathway

positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

positive regulation of activin receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade

positive regulation of cell differentiation [inference]

positive regulation of cell development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of cell division

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

regulation of cell division [inference]

positive regulation of cell division

regulation of cell motility [inference]

regulation of cell migration

regulation of smooth muscle cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

regulation of vascular associated smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of glial cell migration [inference]

regulation of Schwann cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of smooth muscle cell migration [inference]

positive regulation of vascular associated smooth muscle cell migration

positive regulation of glial cell migration [inference]

positive regulation of Schwann cell migration

regulation of multicellular organismal process [inference]

regulation of organ growth [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of organ growth [inference]

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

positive regulation of nervous system development [inference]

positive regulation of neurogenesis [inference]

positive regulation of gliogenesis [inference]

positive regulation of glial cell proliferation [inference]

positive regulation of Schwann cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

positive regulation of cardiac muscle cell proliferation

positive regulation of heart growth [inference]

positive regulation of cardiac muscle tissue growth [inference]

positive regulation of cardiac muscle cell proliferation

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	GO_REF
extracellular region	TAS	Reactome
extracellular region	IEA	GO_REF GO_REF
basement membrane	ISO	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix [inference]

basement membrane

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
fibroblast growth factor receptor binding	ISO	GO_REF
fibroblast growth factor receptor binding	IBA	GO_REF
growth factor activity	ISO	GO_REF
growth factor activity	IBA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

growth factor receptor binding [inference]

fibroblast growth factor receptor binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparin binding

sulfur compound binding [inference]

heparin binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

growth factor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
79	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 30 in total

1

2

3

Next ›

Last »
Pathway Name	Organism
Downstream signaling of activated FGFR1	Mus musculus
FGFR1c ligand binding and activation	Mus musculus
FGFR2c ligand binding and activation	Mus musculus
FGFR3b ligand binding and activation	Mus musculus
FGFR3c ligand binding and activation	Mus musculus
FGFR4 ligand binding and activation	Mus musculus
FRS-mediated FGFR1 signaling	Mus musculus
FRS-mediated FGFR2 signaling	Mus musculus
FRS-mediated FGFR3 signaling	Mus musculus
FRS-mediated FGFR4 signaling	Mus musculus

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:0050794	multiple synostoses syndrome	Alliance of Genome Resources
DOID:4769	pleuropulmonary blastoma	Alliance of Genome Resources
DOID:1324	lung cancer	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements