GlyCosmos Portal

Submissions

Interleukin-12 subunit alpha

Summary

UniProt ID: P54349
Gene Symbol: IL12A
Gene ID: 281856
Organism: Bos taurus (domestic cattle)

External Links

Re-Glyco: P54349

Annotation

Keyword: Cytokine Disulfide bond Glycoprotein Growth factor Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
natural killer cell activation	ISS	PMID
type II interferon production	IDA	PMID
positive regulation of type II interferon production	IDA	PMID
interleukin-12-mediated signaling pathway	IBA	GO_REF
T-helper cell differentiation	ISS	PMID

GO Hierarchy

biological process

immune system process [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

natural killer cell activation

T cell activation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

natural killer cell activation

T cell activation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-12-mediated signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

type II interferon production

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

cytokine production [inference]

type II interferon production

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

multicellular organismal process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

natural killer cell activation

T cell activation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell activation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

cytokine production [inference]

type II interferon production

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

leukocyte differentiation [inference]

mononuclear cell differentiation [inference]

lymphocyte differentiation [inference]

T cell differentiation [inference]

alpha-beta T cell differentiation [inference]

CD4-positive, alpha-beta T cell differentiation [inference]

T-helper cell differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

interleukin-12-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

regulation of type II interferon production [inference]

positive regulation of type II interferon production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

regulation of activated T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production [inference]

positive regulation of type II interferon production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation [inference]

positive regulation of activated T cell proliferation

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
interleukin-12 complex	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

extracellular protein-containing complex [inference]

interleukin-12 complex

Displaying **all 5** entries
GO Term	Evidence Code	Reference
cytokine activity	IBA	GO_REF
interleukin-12 receptor binding	IDA	PMID
interleukin-12 receptor binding	IBA	GO_REF
interleukin-12 receptor binding	IEA	GO_REF
growth factor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

interleukin-12 receptor binding

growth factor receptor binding [inference]

interleukin-12 receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MCPLRSLLLISTLVLLHHLPHLSLGRSLPTTTASPGRSCLDYSQNLLRAVSNTLQKARQTLEFYSCTSEEIDHEDITKDKTSTVEACLPLELATNESCLASRETSFITNGHCLASGKTSFMTTLCLRSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFDSETVPQKPSLKELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
95	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Interleukin-12 signaling	Bos taurus
Interleukin-35 Signalling	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements