GlyCosmos Portal

Submissions

Ectonucleoside triphosphate diphosphohydrolase 1

Summary

UniProt ID: P55772
Gene Symbol: Entpd1 Cd39
Gene ID: 12495
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003705
PubChem: P55772
RaftProt: P55772
Re-Glyco: P55772

Annotation

Keyword: ATP-binding Calcium Disulfide bond GTP-binding Glycoprotein Hydrolase Magnesium Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor signaling pathway	IDA	PMID
nucleoside diphosphate catabolic process	IBA	GO_REF
purine ribonucleoside diphosphate catabolic process	IDA	PMID
platelet activation	IDA	PMID
negative regulation of dopamine secretion	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell activation [inference]

platelet activation

cell adhesion [inference]

cell-cell adhesion [inference]

homotypic cell-cell adhesion [inference]

platelet aggregation

signal transduction [inference]

G protein-coupled receptor signaling pathway

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

catabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

nucleotide metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

nucleoside diphosphate metabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine nucleoside diphosphate metabolic process [inference]

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate metabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleoside phosphate catabolic process [inference]

nucleoside diphosphate catabolic process

purine nucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

ribonucleoside diphosphate catabolic process [inference]

purine ribonucleoside diphosphate catabolic process

ADP catabolic process

nucleotide catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

purine-containing compound metabolic process [inference]

purine nucleotide metabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

purine-containing compound catabolic process [inference]

purine nucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

carbohydrate derivative metabolic process [inference]

ribose phosphate metabolic process [inference]

ribonucleotide metabolic process [inference]

purine ribonucleotide metabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

ADP metabolic process [inference]

ADP catabolic process

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

carbohydrate derivative catabolic process [inference]

ribonucleotide catabolic process [inference]

purine ribonucleotide catabolic process [inference]

ADP catabolic process

multicellular organismal process [inference]

cell activation [inference]

platelet activation

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

regulation of secretion by cell [inference]

regulation of catecholamine secretion [inference]

regulation of dopamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

regulation of amine transport [inference]

regulation of catecholamine secretion [inference]

regulation of dopamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of transport [inference]

negative regulation of secretion [inference]

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of amine transport [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of nucleotide biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of phosphorus metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP metabolic process [inference]

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of small molecule metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP metabolic process [inference]

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of nucleotide metabolic process [inference]

regulation of nucleotide biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of purine nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of purine nucleotide metabolic process [inference]

regulation of purine nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP metabolic process [inference]

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

regulation of ATP biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of phosphorus metabolic process [inference]

negative regulation of phosphate metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of small molecule metabolic process [inference]

negative regulation of nucleotide metabolic process [inference]

negative regulation of nucleotide biosynthetic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of purine nucleotide metabolic process [inference]

negative regulation of purine nucleotide biosynthetic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of ATP metabolic process [inference]

negative regulation of ATP biosynthetic process

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

regulation of secretion by cell [inference]

regulation of catecholamine secretion [inference]

regulation of dopamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

negative regulation of secretion by cell [inference]

negative regulation of catecholamine secretion [inference]

negative regulation of dopamine secretion

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
basement membrane	IDA	PMID
obsolete extracellular space
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

plasma membrane region [inference]

basolateral plasma membrane

plasma membrane raft [inference]

caveola

synaptic membrane

membrane microdomain [inference]

membrane raft [inference]

plasma membrane raft [inference]

caveola

external encapsulating structure [inference]

extracellular matrix [inference]

basement membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

cell body [inference]

neuronal cell body

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 43 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	ISS	GO_REF
GTPase activity	ISO	GO_REF GO_REF
GTPase activity	IEA	GO_REF
apyrase activity	ISS	GO_REF
apyrase activity	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

apyrase activity

nucleoside diphosphate phosphatase activity

ribonucleoside triphosphate phosphatase activity

binding [inference]

protein binding [inference]

identical protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEDIKDSKVKRFCSKNILIILGFTSILAVIALIAVGLTQNKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTDEIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSYPFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQVSSGGVLKDPCFNPGYEKVVNVSELYGTPCTKRFEKKLPFDQFRIQGTGDYEQCHQSILELFNNSHCPYSQCAFNGVFLPPLHGSFGAFSAFYFVMDFFKKVAKNSVISQEKMTEITKNFCSKSWEETKTSYPSVKEKYLSEYCFSGAYILSLLQGYNFTDSSWEQIHFMGKIKDSNAGWTLGYMLNLTNMIPAEQPLSPPLPHSTYIGLMVLFSLLLVAVAITGLFIYSKPSYFWKEAV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
73	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
226	N-linked (GlcNAc...) asparagine	UniProt
291	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
333	N-linked (GlcNAc...) asparagine	UniProt
428	N-linked (GlcNAc...) asparagine	UniProt
457	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Phosphate bond hydrolysis by NTPDase proteins	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements