GlyCosmos Portal

Submissions

Atypical chemokine receptor 3

Summary

UniProt ID: P56485
Gene Symbol: Ackr3 Cmkor1 Cxcr7 Rdc1
Gene ID: 12778
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003708
PubChem: P56485
Re-Glyco: P56485

Annotation

Keyword: Cell adhesion Cell membrane Developmental protein Disulfide bond Endosome G-protein coupled receptor Glycoprotein Phosphoprotein Reference proteome Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	IEA	GO_REF
vasculogenesis	IEA	GO_REF
immune response	IBA	GO_REF
cell adhesion
positive regulation of cytosolic calcium ion concentration	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

cellular process [inference]

cell adhesion

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

chemokine-mediated signaling pathway

G protein-coupled receptor signaling pathway [inference]

chemokine-mediated signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

cellular developmental process [inference]

cell differentiation [inference]

vasculogenesis

cell motility [inference]

cell migration [inference]

cell chemotaxis

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

nerve development [inference]

cranial nerve development [inference]

oculomotor nerve development

cellular developmental process [inference]

cell differentiation [inference]

vasculogenesis

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis

response to stimulus [inference]

immune response

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

regulation of mesenchymal stem cell migration [inference]

positive regulation of mesenchymal stem cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of locomotion [inference]

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of response to stress [inference]

regulation of cellular response to stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

cytokine-mediated signaling pathway [inference]

chemokine-mediated signaling pathway

G protein-coupled receptor signaling pathway [inference]

chemokine-mediated signaling pathway

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of intrinsic apoptotic signaling pathway [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

positive regulation of cellular process [inference]

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of cellular response to stress [inference]

regulation of intrinsic apoptotic signaling pathway in response to DNA damage [inference]

negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

regulation of mesenchymal stem cell migration [inference]

positive regulation of mesenchymal stem cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of mesenchymal stem cell migration

regulation of biological quality [inference]

positive regulation of cytosolic calcium ion concentration

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
endosome	ISS	GO_REF
endosome	ISO	GO_REF
endosome	IEA	GO_REF
early endosome	ISS	GO_REF
early endosome	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
scavenger receptor activity	ISS	GO_REF
scavenger receptor activity	ISO	GO_REF
scavenger receptor activity	IEA	GO_REF
coreceptor activity	IEA	GO_REF
C-C chemokine receptor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytokine binding [inference]

chemokine binding [inference]

cargo receptor activity [inference]

scavenger receptor activity

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity [inference]

chemokine receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled chemoattractant receptor activity [inference]

chemokine receptor activity [inference]

coreceptor activity

immune receptor activity [inference]

cytokine receptor activity [inference]

chemokine receptor activity [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDVHLFDYAEPGNYSDINWPCNSSDCIVVDTVQCPTMPNKNVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVITIPVWVVSLVQHNQWPMGELTCKITHLIFSINLFGSIFFLACMSVDRYLSITYFTGTSSYKKKMVRRVVCILVWLLAFFVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVILGFAVPFTIIAIFYFLLARAMSASGDQEKHSSRKIIFSYVVVFLVCWLPYHFVVLLDIFSILHYIPFTCQLENVLFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQNTK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
13	N-linked (GlcNAc...) asparagine	UniProt
22	N-linked (GlcNAc...) asparagine	UniProt
192		GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Chemokine receptors bind chemokines	Mus musculus
G alpha (i) signalling events	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements