GlyCosmos Portal

Submissions

Ras-related C3 botulinum toxin substrate 3

Summary

UniProt ID

P60763

Gene Symbol

RAC3

Gene ID

5881

Organism

Homo sapiens (human)

External Links

GlyGen: P60763
PubChem: P60763
The Human Metabolome Database: HMDBP08516
RaftProt: P60763
Re-Glyco: P60763

Annotation

Keyword: 3D-structure Cell membrane Cell projection Cytoskeleton Disease variant GTP-binding Glycoprotein Hydrolase Intellectual disability Isopeptide bond Methylation Prenylation Proteomics identification Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
actin filament organization	IBA	GO_REF
establishment or maintenance of cell polarity	IBA	GO_REF
motor neuron axon guidance	IBA	GO_REF
regulation of cell shape	IBA	GO_REF
regulation of neuron maturation

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

synaptic transmission, GABAergic

establishment or maintenance of cell polarity

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

intracellular signal transduction

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rac protein signal transduction

metabolic process [inference]

respiratory burst

actin filament-based process [inference]

actin cytoskeleton organization

postsynaptic actin cytoskeleton organization

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

central nervous system neuron development [inference]

forebrain neuron development [inference]

cerebral cortex GABAergic interneuron development

cell motility [inference]

cell migration [inference]

cell chemotaxis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization

postsynaptic actin cytoskeleton organization

cortical cytoskeleton organization

postsynaptic cytoskeleton organization [inference]

postsynaptic actin cytoskeleton organization

cellular component assembly [inference]

cell projection assembly

cell projection organization [inference]

cell projection assembly

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance [inference]

motor neuron axon guidance

supramolecular fiber organization [inference]

actin filament organization

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

neuromuscular process [inference]

neuromuscular process controlling balance

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

developmental process [inference]

anatomical structure development [inference]

cell development [inference]

neuron development [inference]

central nervous system neuron development [inference]

forebrain neuron development [inference]

cerebral cortex GABAergic interneuron development

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

central nervous system neuron development [inference]

forebrain neuron development [inference]

cerebral cortex GABAergic interneuron development

locomotion [inference]

taxis [inference]

chemotaxis [inference]

cell chemotaxis

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

homeostasis of number of cells [inference]

homeostasis of number of cells within a tissue

anatomical structure homeostasis [inference]

tissue homeostasis [inference]

homeostasis of number of cells within a tissue

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

regulation of leukocyte migration [inference]

regulation of neutrophil migration

signaling [inference]

cell-cell signaling [inference]

synaptic signaling [inference]

trans-synaptic signaling [inference]

anterograde trans-synaptic signaling [inference]

chemical synaptic transmission [inference]

synaptic transmission, GABAergic

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

regulation of neutrophil migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of substrate adhesion-dependent cell spreading

positive regulation of cell adhesion mediated by integrin

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of cell morphogenesis [inference]

regulation of cell shape

regulation of cell differentiation [inference]

regulation of neuron differentiation [inference]

regulation of neuron maturation

regulation of cell development [inference]

regulation of cell maturation [inference]

regulation of neuron maturation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

intracellular signal transduction

intracellular signaling cassette [inference]

small GTPase-mediated signal transduction [inference]

Rac protein signal transduction

regulation of cell adhesion [inference]

regulation of cell-substrate adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of substrate adhesion-dependent cell spreading

regulation of substrate adhesion-dependent cell spreading [inference]

positive regulation of substrate adhesion-dependent cell spreading

regulation of cell adhesion mediated by integrin [inference]

positive regulation of cell adhesion mediated by integrin

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of substrate adhesion-dependent cell spreading

positive regulation of cell adhesion mediated by integrin

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization

regulation of cellular component biogenesis [inference]

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

regulation of postsynapse assembly

regulation of cell differentiation [inference]

regulation of neuron differentiation [inference]

regulation of neuron maturation

regulation of cell development [inference]

regulation of cell maturation [inference]

regulation of neuron maturation

positive regulation of cellular process [inference]

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of substrate adhesion-dependent cell spreading

positive regulation of cell adhesion mediated by integrin

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization

regulation of synapse organization [inference]

regulation of synapse assembly [inference]

regulation of postsynapse assembly

regulation of postsynapse organization [inference]

regulation of postsynapse assembly

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

regulation of postsynapse assembly

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

regulation of neutrophil migration

regulation of biological quality [inference]

regulation of cell shape

Displaying entries **1 - 5** of 26 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum membrane	TAS	Reactome Reactome
cytosol	TAS	Reactome
cytoskeleton	IBA	GO_REF
cytoskeleton	IEA	GO_REF
plasma membrane	NAS	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

filamentous actin

membrane protein complex [inference]

plasma membrane protein complex [inference]

NADPH oxidase complex

catalytic complex [inference]

oxidoreductase complex [inference]

NADPH oxidase complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

endoplasmic reticulum membrane

cell junction [inference]

synapse [inference]

glutamatergic synapse

site of polarized growth [inference]

growth cone

cell projection [inference]

plasma membrane bounded cell projection [inference]

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

extracellular vesicle [inference]

extracellular exosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membraneless organelle [inference]

cytoskeleton

extracellular organelle [inference]

extracellular membrane-bounded organelle [inference]

extracellular vesicle [inference]

extracellular exosome

cell body [inference]

neuronal cell body

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
GTPase activity	EXP	PMID
GTPase activity	IDA	PMID
GTPase activity	IEA	GO_REF GO_REF
G protein activity	IEA	GO_REF
GTP binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on acid anhydrides [inference]

hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides [inference]

pyrophosphatase activity [inference]

ribonucleoside triphosphate phosphatase activity [inference]

GTPase activity

G protein activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

calcium-dependent protein binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

GTP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

guanyl nucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

guanyl ribonucleotide binding [inference]

GTP binding

purine ribonucleoside triphosphate binding [inference]

GTP binding

molecular function regulator activity [inference]

G protein activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites